sigD

Probable spore coat protein sigD

445 amino acids

May contribute to the structure of the coat at the interface between the middle, cellulosic layer and the outer, electron-dense, proteinaceous layer.

47.051 kDa

MKKVITLLALMAAAQIYAQGQECINLSENECHRNSSCVPVNFKKCCGDQQFACYEGDFNSCHYITKCYKSSKSLDVIESTNECYIPPAGYELFEPVSSCTNDELKHCSDQGKQCIFKRNDCPNPTSCCPGHGVCEDFNRSESGSGNKEQISTTGNTGPQTRGFTISGTGGTGSVPIDACTNVLCQQGEHCEVDQDGRAHCYVNIESIGTLPLGCLNVVCQPHQHCEIDKESGLAHCVLDINPIGFTTIDASSTVAGSSSTTGGSGGTGSNDICSNVHCPDNYHCEMRQDGKAQCVADINAIGFTTSGASTNGLIPPASTGWSDVCSNVICPPGYYCQKNEQTGKADCLNYSSSTTGGGTGSTTGSIDVCSNVICPPYFHCEKNDKGWAQCAADINAIGFSTSSTNGLVSTTGSNDVCQNVHCPQFFKCEKNENGLGECVSTLIPL

SIGD

RNA polymerase sigma factor sigD, chloroplastic

419 amino acids

Sigma factors are initiation factors that promote the attachment of plastid-encoded RNA polymerase (PEP) to specific initiation sites and are then released. Regulates transcription of the ndhF gene which codes for a subunit of the plastid NDH [NAD(P)H dehydrogenase] complex.

Belongs to the sigma-70 factor family.

47.165 kDa

MATTIPTTATATMCPSPPVPTISPLLRTTHQCQPSPSLSSPFSIKLSTALVCGDTTVDRVVDSSVMIKPEKWGIQSEKRRKRRRRRRVGYERLEPEEEENAGVEAEAETISVPVVGASRSGFLSRLEEVQLCLYLKEGAKLENLGTSVEENEMVSVLLASGRGKKKRSANEILCRRKEAREKITRCYRRLVVSIATGYQGKGLNLQDLIQEGSIGLLRGAERFDPDRGYKLSTYVYWWIKQAILRAIAHKSRLVKLPGSMWELTAKVAEASNVLTRKLRRQPSCEEIAEHLNLNVSAVRLAVERSRSPVSLDRVASQNGRMTLQEIVRGPDETRPEEMVKREHMKHEIEQLLGSLTARESRVLGLYFGLNGETPMSFEEIGKSLKLSRERVRQINGIALKKLRNVHNVNDLKIYYSSSE

sigD

RNA polymerase sigma-D factor

254 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This alternative sigma factor is required for the transcription of the flagellin and motility genes as well as for wild-type chemotaxis.

Belongs to the sigma-70 factor family.

29.468 kDa

MQSLNYEDQVLWTRWKEWKDPKAGDDLMRRYMPLVTYHVGRISVGLPKSVHKDDLMSLGMLGLYDALEKFDPSRDLKFDTYASFRIRGAIIDGLRKEDWLPRTSREKTKKVEAAIEKLEQRYLRNVSPAEIAEELGMTVQDVVSTMNEGFFANLLSIDEKLHDQDDGENIQVMIRDDKNVPPEEKIMKDELIAQLAEKIHELSEKEQLVVSLFYKEELTLTEIGQVLNLSTSRISQIHSKALFKLKNLLEKVIQ

sigD

ECF RNA polymerase sigma factor SigD

212 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis.

Belongs to the sigma-70 factor family. ECF subfamily.

22.919 kDa

MVDPGVSPGCVRFVTLEISPSMTMQGERLDAVVAEAVAGDRNALREVLETIRPIVVRYCRARVGTVERSGLSADDVAQEVCLATITALPRYRDRGRPFLAFLYGIAAHKVADAHRAAGRDRAYPAETLPERWSADAGPEQMAIEADSVTRMNELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLKDEIVAAGDYA

sigD

ECF RNA polymerase sigma factor SigD

212 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

22.919 kDa

MVDPGVSPGCVRFVTLEISPSMTMQGERLDAVVAEAVAGDRNALREVLETIRPIVVRYCRARVGTVERSGLSADDVAQEVCLATITALPRYRDRGRPFLAFLYGIAAHKVADAHRAAGRDRAYPAETLPERWSADAGPEQMAIEADSVTRMNELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLKDEIVAAGDYA

sigD

ECF RNA polymerase sigma factor SigD

212 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis.

Belongs to the sigma-70 factor family. ECF subfamily.

22.919 kDa

MVDPGVSPGCVRFVTLEISPSMTMQGERLDAVVAEAVAGDRNALREVLETIRPIVVRYCRARVGTVERSGLSADDVAQEVCLATITALPRYRDRGRPFLAFLYGIAAHKVADAHRAAGRDRAYPAETLPERWSADAGPEQMAIEADSVTRMNELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLKDEIVAAGDYA