SELENON

Selenoprotein N

590 amino acids

Essential for muscle regeneration and satellite cell maintenance in skeletal muscle (PubMed:21131290).

65.813 kDa

MGRARPGQRGPPSPGPAAQPPAPPRRRARSLALLGALLAAAAAAAVRVCARHAEAQAAARQELALKTLGTDGLFLFSSLDTDGDMYISPEEFKPIAEKLTGSCSVTQTGVQWCSHSSLQPQLPWLNUSSCLSLLRSTPAASCEEEELPPDPSEETLTIEARFQPLLPETMTKSKDGFLGVSRLALSGLRNWTAAASPSAVFATRHFQPFLPPPGQELGEPWWIIPSELSMFTGYLSNNRFYPPPPKGKEVIIHRLLSMFHPRPFVKTRFAPQGAVACLTAISDFYYTVMFRIHAEFQLSEPPDFPFWFSPAQFTGHIILSKDATHVRDFRLFVPNHRSLNVDMEWLYGASESSNMEVDIGYIPQMELEATGPSVPSVILDEDGSMIDSHLPSGEPLQFVFEEIKWQQELSWEEAARRLEVAMYPFKKVSYLPFTEAFDRAKAENKLVHSILLWGALDDQSCUGSGRTLRETVLESSPILTLLNESFISTWSLVKELEELQNNQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQP

selenon

Selenoprotein N

562 amino acids

Plays an important role in cell protection against oxidative stress and in the regulation of redox-related calcium homeostasis. Regulates the calcium level of the ER by protecting the calcium pump ATP2A2 against the oxidoreductase ERO1A-mediated oxidative damage. Acts as a modulator of ryanodine receptor (RyR) activity. Plays an important role in muscle development and differentiation during early development.

64.071 kDa

MSADLRKRKKDTTADNDAPQEAQAEEENKKEKPSSCRYRFLWKLLLGLLLIALLFGIKIHRDNELVRQQEAALRTLGAEGLFLFSSLDTDNDMHISPEEFKPISEKLTGISTTSDYEEEELLDPNGETLSVASRFQPLLMETMTKSKDGFLGITHSALSGLRNWTTPVVPNNVFYAGQFKAFLPPKNKLEVGNPWWIIPSELSIFTGYLPNNRIYPPPPKGKEVIIHKLLSMFHPRPFIKTRFAPQGSVACIRAISDFYYDIVFRIHAEFQLNEPPNFPFWFSPGQFTGNIVISKDAAHVRHFKLFVPNNRTLNVDMEWLYGASESSNMEVDIGYLPQMEIESLGPSIPSTIYDENGNIMESRNAEGEAIEFVFEDINWQSEMTFEEAARKLEVTMYPFKRVSYYPFPEAFDRALAEKKLVHSVLLWGALDDQSCUGSGRTLRETVLESLPVLALLNESFISTWSLVKELEELQSNKDSYATFASLHLEKYNFPVEMMICLPNGTVVHHINANYFLDITSLKPDEVETNLFSFSDGVEDLSTVTYIKFLKEGLEKAKPFLHS

selenon

Selenoprotein N

557 amino acids

Plays an important role in cell protection against oxidative stress and in the regulation of redox-related calcium homeostasis. Regulates the calcium level of the ER by protecting the calcium pump ATP2A2 against the oxidoreductase ERO1A-mediated oxidative damage (By similarity). Acts as a modulator of ryanodine receptor (RyR) activity: protects RyR from oxidation due to increased oxidative stress, or directly controls the RyR redox state, regulating the RyR-mediated calcium mobilization required for normal muscle development and differentiation (PubMed:18713863). Plays an important role in muscle development and differentiation during early development. Required for development of the slow muscle fiber lineage (PubMed:18713863). Required for the correct organization and attachment of the myofibrils, as well as for the continuity and integrity of the connective tissue that forms the myoseptum (PubMed:17123513).

62.624 kDa

MAADVDKTPAGEQKDDHEDRGTPSSRRGRSRFTQISSLFIIAAIPVIGVCIKYYLDIQFVKRHEAGLKALGADGLFFFSSLDTDHDLYLSPEEFKPIAEKLTGVAPPPEYEEEIPHDPNGETLTLHAKMQPLLLESMTKSKDGFLGVSHSSLSGLRSWKRPAISSSTFYASQFKVFLPPSGKSAVGDTWWIIPSELNIFTGYLPNNRFHPPTPRGKEVLIHSLLSMFHPRPFVKSRFAPQGAVACIRATSDFYYDIVFRIHAEFQLNDVPDFPFWFTPGQFAGHIILSKDASHVRDFHIYVPNDKTLNVDMEWLYGASETSNMEVDIGYLPQMELGAEGPSTPSVIYDEQGNMIDSRGEGGEPIQFVFEEIVWSEELRREEASRRLEVTMYPFKKVPYLPFSEAFSRASAEKKLVHSILLWGALDDQSCUGSGRTLRETVLESSPVLALLNQSFISSWSLVKELEDLQGDVKNVELSEKARLHLEKYTFPVQMMVVLPNGTVVHHINANNFLDQTSMKPEDEGPGLSFSAGFEDPSTSTYIRFLQEGLEKAKPYLES

Selenon

Selenoprotein N

557 amino acids

Plays an important role in cell protection against oxidative stress and in the regulation of redox-related calcium homeostasis. Regulates the calcium level of the ER by protecting the calcium pump ATP2A2 against the oxidoreductase ERO1A-mediated oxidative damage. Within the ER, ERO1A activity increases the concentration of H(2)O(2), which attacks the luminal thiols in ATP2A2 and thus leads to cysteinyl sulfenic acid formation (-SOH) and SEPN1 reduces the SOH back to free thiol (-SH), thus restoring ATP2A2 activity (PubMed:25452428). Acts as a modulator of ryanodine receptor (RyR) activity: protects RyR from oxidation due to increased oxidative stress, or directly controls the RyR redox state, regulating the RyR-mediated calcium mobilization required for normal muscle development and differentiation (By similarity). Essential for muscle regeneration and satellite cell maintenance in skeletal muscle (PubMed:21131290).

62.492 kDa

MGQARPAARRPHSPDPGAQPAPPRRRARALALLGALLAAAAAVAAARACALLADAQAAARQESALKVLGTDGLFLFSSLDTDQDMYISPEEFKPIAEKLTGSVPVANYEEEELPHDPSEETLTIEARFQPLLMETMTKSKDGFLGVSRLALSGLRNWTTAASPSAAFAARHFRPFLPPPGQELGQPWWIIPGELSVFTGYLSNNRFYPPPPKGKEVIIHRLLSMFHPRPFVKTRFAPQGTVACLTAISDSYYTVMFRIHAEFQLSEPPDFPFWFSPGQFTGHIILSKDATHIRDFRLFVPNHRSLNVDMEWLYGASETSNMEVDIGYVPQMELEAVGPSVPSVILDEDGNMIDSRLPSGEPLQFVFEEIKWHQELSWEEAARRLEVAMYPFKKVNYLPFTEAFDRARAEKKLVHSILLWGALDDQSCUGSGRTLRETVLESPPILTLLNESFISTWSLVKELEDLQTQQENPLHRQLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRRGLPLLQP