sasP-C

Small, acid-soluble spore protein C

72 amino acids

SASP are bound to spore DNA. They are double-stranded DNA-binding proteins that cause DNA to change to an a-like conformation. They protect the DNA backbone from chemical and enzymatic cleavage and are thus involved in dormant spore's high resistance to UV light.

Belongs to the alpha/beta-type SASP family.

7.554 kDa

MANYQNASNRNSSNKLVAPGAQAAIDQMKFEIASEFGVNLGPDATARANGSVGGEITKRLVQLAEQNLGGKY