Function
Functions in the regulation of endosome morphology and late endosome formation. Has a role in controlling trafficking from early to late endosomes and from late endosomes to lysosomes. Important for localization of Gdi to the endosomal membranes. May function in controlling the activity of multiple regulators in the endocytic pathway, perhaps by positively controlling those involved in the early steps of endocytosis such as Rab5 and hrs, and negative regulating those involved in the late stages of endocytosis like car and VhaSFD.
Sequence
MVDRLVNSEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYGNIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCVEDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDACYERLKHVPSSLGSGEDSAAATGAASGNKLNTTAGDSSNDEDSDEETASPGGESHDEPRFYGDNSVLSAVEDSSTITSPSSATTGSLEAPQVTPSVQSSPAAVATTGSHC