About Products Protein Database Contact

rsph1

Gene
RSPH1
Protein
Radial spoke head 1 homolog
Organism
Homo sapiens
Length
309 amino acids
Function
May play an important role in male meiosis (By similarity). It is necessary for proper building of the axonemal central pair and radial spokes.
Mass
35.124 kDa
Sequence
MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD

Gene
Rsph1
Protein
Radial spoke head 1 homolog
Organism
Mus musculus
Length
301 amino acids
Function
The specific expression during male germ cell development and its characteristic localization suggest that it may play an important role in male meiosis. It is necessary for proper building of the axonemal central pair and radial spokes (By similarity).
Mass
34.181 kDa
Sequence
MSDLGSEELEEEGENDLGEYEGERNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNPVGPGKYVFDIGCEQHGEYRLTDTERGEEEEEEETLVNIVPKWKALNITELALWTPTLSEEQPPPEGQGQEEPQGLTGVGDPSEDIQAEGFEGELEPRGADEDVDTFRQESQENSYDIDQGNLNFDEEPSDLQD

Gene
rsph1
Protein
Radial spoke head 1 homolog
Organism
Cyprinus carpio
Length
218 amino acids
Function
May play an important role in male meiosis (By similarity). May be involved in flagellar differentiation during spermiogenesis.
Mass
24.566 kDa
Sequence
MSDAGTEEFDEEQGSLGEYEGDRNEAGERHGQGKAVLPRGDTYQGAYENGKRCGQGTYKFKNGARYTGEWYMNLKHGQGVLYYPDGSKYEGSWVDDQRQGHGVYTYPNGDTYDGEWLHHQRHGQGTYTHQETGSQYRGTWVVGNMESTGELIQLNHRYHGNFVNNNPSGPGKYVFDIGCEQHGEYFQLEPDKGEAEEDETLISTTLKWKPKAVTGLSV