About Products Protein Database Contact

rsm7

Gene
rsm7
Protein
37S ribosomal protein S7, mitochondrial
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
259 amino acids
Similarity
Belongs to the universal ribosomal protein uS7 family.
Mass
29.559 kDa
Sequence
MLRLIKQPLFRCASSGHLMKESLVFIHQTRTFQVGKFTSNEKYNEKIEDINERSNPQWDNAGLENLLNQLQDSVEQSASDDFMGELEKKIEVENEEPPLMGTNLWPSPSSSIVGLIDRPFQVDSTVQHLVNLIMRDGKKAKAEKIVATALSIIQKETGENPIDVLKQAIAEISPLMKLVSAKRFNKSVEFPMPLKERQRRRIALQWILGECKSSSPKRLSDRIVKEIIAIRSKTSNCFKKKDHLHRMCLVNRGNAPVRI

Gene
RSM7
Protein
37S ribosomal protein S7, mitochondrial
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
247 amino acids
Function
Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane.
Similarity
Belongs to the universal ribosomal protein uS7 family.
Mass
27.816 kDa
Sequence
MLHCARRYMLVRPRLLWQSGTCVARFQSSVRTPASEPSAEKGVDEWLEAINELREEFSAKEYLPETSLAPPGQSKVDLLQGSQAGSKIKPTAEQLAQWEALKSVPIPPRKNATLDHITNMIMRHGKKEKAQTILSRALYLVYCQTRQDPIQALEKSLDELAPLMMTKTFNTGVAKASVIPVPLNKRQRNRIAWNWIVQSANQRVSSDFAVRLGEELTAIAKGTSSAFEKRDQIHKTAIAHRAYIQLK