About Products Protein Database Contact

rsm27

Gene
RSM27
Protein
Mitochondrial 37S ribosomal protein S27
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
110 amino acids
Function
Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane.
Similarity
Belongs to the mitochondrion-specific ribosomal protein mS33 family.
Mass
12.393 kDa
Sequence
MNVPKARLLKVAELSAKIFDQNFNPSGIRTGSKILNERLKGPSVASYYGNPDILKFRHLKTLYPDIEFVDLEEQYRLSMVEAKKRRGKGAPKKMKKDAAATAKGKGKKKK

Gene
rsm27
Protein
37S ribosomal protein S27, mitochondrial
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
93 amino acids
Function
Involved in mitochondrial genome encoded proteins translation.
Similarity
Belongs to the mitochondrion-specific ribosomal protein mS33 family.
Mass
10.698 kDa
Sequence
MASKAILEELNILSSKIFGTQYKSNNSRTGRKFVVQELKGAKLKSYYPATINYRQLRTLLNDKTFPDSDEELRMEIRKGRIRQGKGASKSKKK