rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

358 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.803 kDa

MNQTHTFCDTLISTSNPLKQLGWKPFFQQQLTLDDYDNTIFARVIAHHRSGYLLATEAGQVHLNVHHSLPNMTVGDWVILNEDQQFVRLLDRLSLFSRKAAGSKVAEQLIAANVDTVFIVCSLNHDFNLSRIERYLALVHEADVEPVIVLSKADLCDDVDELKSQVQKLDPLLVIETVNGLDAESTSKLMSWCNEGQTVAFIGSSGVGKSTLVNALLGQQEQSTGHIREDDSKGRHTTTSRSIHLLPAGGILIDTPGMREIQLVDCEAGVSEAFADVEALADHCRFGDCKHQTEPGCAVQAAIENGSLEVRRFNNYQKLLREQAFNGATLAEQRAQSRQFGKLTRNVMSDKRKRQQSY

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

353 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.475 kDa

MNLDLLGWSDFFTHSFVPYRQQGFSVGRVAIEYRNTYIVYSKQGELAAKVTGKLRHQATQPQDFPAVGDWVIIQTRESEGCATIHGILPRKSKFSRKTVGSKTEEQIVAANVDTVFLVCGLDGDFNPRRIERYLILAWESGANPVIVLNKADLCNSLDECISEVEAVAIGVPILVLSATNNQGIDTLKAYLQPGQTVALLGSSGVGKSTITNQLKGASVQAVQPVRQGDDRGRHTTTNRELILLPTGGLIVDTPGMREIQIWAGDESLQETFADIETLAPECRFRNCQHHNEPGCAVQQALLEGELDYSRFLGYQKLQKELNYLVRKQEQRAQLAQKERWKKIHKAMRNHHQY

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

353 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.787 kDa

MNNTMTSSQPYTLTQLGWKPFFQQQLTLEDYENTQICRIVAHHRSGYQLCSEQGRFHLAIHHAQPKMTVGDWVLLDEQQQFKRLLERQSELSRKAAGSKIAEQLIATNVDTLFIVCSLNDDFNLSRIERYLSIAKEAHIEPVVVLTKADLSPQAEQNITQVQQLSATLWVEAVNALDPASVSALQPWCTKGRTVAFIGSSGVGKSTLTNTLLGEETQQTGGIREDDSKGRHTTTARSVHMIPDGALIIDTPGMRELQLADCSEGVSETFAEIETLAQHCRFKDCQHQQEPGCAVQQAINNGTLEARRLQNYFKLQREQAYNASTFAEQRNRMKQFGKMCRHVQSDKQKLKTTY

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

352 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.312 kDa

MTINLIKYGLTTAVQADLTKENGQILGRIIGQHRDWYQVITTAGERSAQVTGKLAYEAASPAAFPAVGDWVCLSSSADNQAQIEAIAPRQSVLARGAVNRQDGQIIATNINTIFICMSLNADFNVRRLERYLTIAWDSGALPVIVLTKADLCTDLATKLRAVADVSVGVPTITCSVETGQGLDELQPYLTTGQTVAFVGSSGVGKSTLINRLLGQDILATKSIRTDDNKGRHTTTSRQLIPLPTGACVIDTPGMRELQIFMGDLNQTFAEIAALATQCKFNDCTHTSEPGCAVRAAVEVGTVTSERLQSYQKLQREMSYQGLNSRQLEQAKIQRMFGGKQAMKRVKQRYHRD

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

349 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.302 kDa

MTSSQPYTLTQLGWKPFFQQQLTLEDYENTQICRIVAHHRSGYQLCSEQGRFHLAIHHAQPKMTVGDWVLLDEQQQFKRLLERQSELSRKAAGSKIAEQLIATNVDTLFIVCSLNDDFNLSRIERYLSIAKEAHIEPVVVLTKADLSPQAEQNITQVQQLSATLWVEAVNALDPVSVAALQPWCAKGRTVAFIGSSGVGKSTLTNTLLGEETQQTGGIREDDSKGRHTTTARSVHMIPDGALIIDTPGMRELQLADCSEGVSETFAEIETLAQHCRFKDCQHQQEPGCAVQQAIDNGTLEARRLQNYFKLLREQAYNASTFAEQRNRIKQIGKMYRHVQSDKQKLKTTY

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

346 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.07 kDa

MTLEQYGFTNFFKEQKIAATSSYGRVTAVFRDYYRVITENEEFLASLKRGNFYELSSTSLPAVGDFVEVSSDAQILSVLERKTVFSRMNKDSEEQLIAANFDYALIVMSLNHDFNLNRLERYLTVAWDSGATPIIILTKADLVEDLTAFAQQLETVAYGVPAYYVDNLSHHGFEALERDLKPNSTLVLLGSSGVGKSSFINSLAGTDLMKTAGIREDDSKGKHTTTHREMHLLTNGWIVIDTPGMREFGVGFNQAGLETTFSDVEELAEGCRFHDCSHTQEPGCAVKAALEDGTLTMQHYENWLKLQREMAYHARKNSPALARQERDRWKVIQKSLRTHLKTRPKK

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

310 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.835 kDa

MKGLVIKNTGSWYQVKTDDGQFIECKIKGNFRLKGIRSTNPVAVGDRVQIILNQEGTAFINEIEDRKNYIIRRSSNLSKQSHILAANLDQCMLVVTVNYPETSTIFIDRFLASAEAYRVPVKLVFNKVDAYNEDELRYLDALINLYTHIGYPCFKVSAKEGTGVDAIKKDLEGKITLFSGHSGVGKSTLINAILPGTKVKTGEISTYHNKGMHTTTFSEMFSVDGDGYIIDTPGIKGFGTFDMEEEEIGHYFPEIFKVSADCKYGNCTHRHEPGCAVREAVEKHLISESRYTSYLNMLEDKEEGKYRAAY

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.617 kDa

MAEGRIIKALSGFYYVQSDNQQFVCKGRGLFRNKKITPLVGDYVEFEPKDDNEGYIMEIKERSNELVRPPIANIDQAIIVSSAVDPDFTTLLLDRFLVLIESKHIQPIILITKVDLLNEDQLENIKLYKQHYEKIGYRVELVSSKNQDLLPELEPYFDEKVSVFAGQSGVGKSSLINVLDPSLLLETAEISKSLGRGKHTTRHVELMKIGNGLVADTPGFSVLEFREIEAEELADSFPEFNARMHLCKFRGCMHDKEPKCAVKEAVENEEIAVFRYNHYLRFLEEIQTRKPRY

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.741 kDa

MLEGQIIKALSGFYYVFSEGKIYQCRARGNFRKRNISPLVGDDVEFQVENKTDGYILDVLSRENALVRPPVANIDIAILVFSAVEPDFSTNLADRFLVAIEKEDIQPVICISKMDLATDAEKEQIAVYKEVYETIGYDVFVTNDEPDKEAIKDYISGKTAVIAGQSGVGKSTLLNSLNSDLTLKTAEISNSLGRGKHTTRHVELMPIGDGFVADTPGFSSIEWDDLQPETLQFCFPEMEDRRSGCKFRGCMHDNEPNCAVKTAVEANEIADFRYKHYIQILQELKNRKPRY

rsgA2

Small ribosomal subunit biogenesis GTPase RsgA 2

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.744 kDa

MLEGQIIKALSGFYYVFSEGKVYQCRARGNFRKRNISPLVGDDVEFQIENKTDGYILDVMSRENALVRPPVANIDIAILVFSAVEPDFSTNLADRFLVAIEKEDIKPVICISKMDLASESEKEQIAVYKDIYEAIGYDVFVTNDEPDKEAIKDYISGKTAVIAGQSGVGKSTLLNSLNSDLTLKTAEISNSLGRGKHTTRHVELMPIGDGFVADTPGFSSIEWDDLQPETLQFCFPEIEDRRSGCKYRGCMHENEPSCAVKTAVEANEIAEFRYKHYIQILQELKNRKPRY