rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

370 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

41.447 kDa

MRVFTTGQLLGTVVAVQANFYKVQLDQEVREQGSRGAGEEVHLDSPLPLCPLSLLLCTRRTRLKKIGQQVMVGDRVVVEEPDWAGGRGAIADVLSRQTQLDRPPIANADQILLVFAVADPPLEPYQLSRFLVKAETTGLDVVLCLNKSDLVSPEIQQQISDRLLAWGYQPLFISVENQINIDQIAKYLSNKITVVAGPSGVGKSSLINALIPNINLRVGEVSGKLARGRHTTRHVELFELPNGGLLADTPGFNQPDVDCSPEELVHYFPEARERLAIASCRFNDCSHRDEPDCAVRGDWERYEHYLEFLADAIARQTQLYQQADPESTLKLKTKGKGQSQYEPKLESKKYRRTSRRTQVQGLQDLYQEEE

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

355 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

40.311 kDa

MSNENNNLSLYGWSDNLFRQKQISQYKDMSHGRIIVTHKTCYEVVAEDGVYLCELTGNMIYGRVPDEYPCTGDWVIFQPFDANKGIIVDILPRERALYRKKNGRVADRQAIASYVDKAFIVQSLDDNFNVRRAERFIAQVMEEKIKPVLVLNKADLGCDRQKIDEAIKHIARQFPVFITSIRQPQTILRLRESITKGETVVFVGSSGVGKSSLVNALCGKSVLNTSDISLSTGKGRHTSTRREMVLMDGSGVLIDTPGVREFGLAIDNPDSLTEMFEISDYAESCRFSDCKHIDEPGCAVLEAVHNGTLDHKVYESYLKLRREAWHFSASEHEKRKKEKSFTKLVEEVKKRKANF

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

354 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.997 kDa

MAKKKKLTKGQVRRVRSNQQKRLKKQEESIQWDENMLGASKQGLVITRFGQHADIEDLETGEVQRCNLRRGIESLVSGDRVLWREGLESMAGISGVVEAVEPRTSMLTRPDYYDGLKPVAANIDQMVIVSSVLPELSLNIIDRYLVAAETLNIAPLLVLNKVDLLEVDDRAMYEEWLKEYERIGYKVLFVSKNSGEGISDLEVQLRDRINIFVGQSGVGKSSLVNALMPELEQEVEEGAISENSGLGQHTTTAARLYHIPTGGDLIDSPGVREFGLWHLEAEEVTKAFVEFRPYLGGCKFRDCKHNDDPGCILREAVEKGEVSEVRFENYHRILESMMENKANRQYSRNKKADL

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

352 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.495 kDa

MAKKKKLTQGQVRRVRDNQQKRLKKQADTIQWDEAMLGDSRRGLVITRFGQHADIEDAETGLIERCNLRRGIESLVSGDKVIWRKGLESMAGISGVVEAVEPRTSVLTRPDYYDGLKPVAANIDQMVIVSSVLPELSLNIIDRYLIAAETLGIEPLLVLNKIDLLQEAELATYREWLADYEKIGYKILYVSKRSGAGIAELEAQLQDRINIFVGQSGVGKSSLVNALIPELDIEEGEISELSGLGQHTTTAARLYHIPSGGNLIDSPGVREFGLWHLEPEEITKAYLEFRPYLGGCKFRDCKHADDPGCIIREAVENGEISEVRYDNYHRIIESMAENKANRQYSRNKKADL

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

352 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.495 kDa

MAKKKKLTQGQVRRVRDNQQKRLKKQADTIQWDEAMLGDSRRGLVITRFGQHADIEDAETGLIERCNLRRGIESLVSGDKVIWRKGLESMAGISGVVEAVEPRTSVLTRPDYYDGLKPVAANIDQMVIVSSVLPELSLNIIDRYLIAAETLGIEPLLVLNKIDLLQEAELATYREWLADYEKIGYKILYVSKRSGAGIAELEAQLQDRINIFVGQSGVGKSSLVNALIPELDIEEGEISELSGLGQHTTTAARLYHIPSGGNLIDSPGVREFGLWHLEPEEITKAYLEFRPYLGGCKFRDCKHADDPGCIIREAVENGEISEVRYDNYHRIIESMAENKANRQYSRNKKADL

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

351 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

40.008 kDa

MNLNEFQQKYAYRKEINYDGQIDLLARVVMEQKERYILQTINGFKPAVVKGKMRHEAISREDYPAVGDWVVLQEKDFNDIVIIDQVLPRFSSIVRKVAGLRTDAQIVASNVTKVFIVISADEDLNERKLERYLTAVWESGASPHIVFSKVDLASDMDSIIEHADSIAFGIPLYKWNATNEEGKEDILANIHEDDSVVLIGSSGAGKSTLINALLTEKVLKTGSVREDDKRGRHTTTHRELFNLPTGGVIIDTPGMRELQLWTEDGDTLSHTFSDINHLIAECKFTDCKHDTEPDCAVKEALETGDLEEGRWNSYLKLQRELAYIERKQNAKLATEERKKWKKISMQQKKNR

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

346 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.196 kDa

MILEKYGFTSFFEEQKIAATSSYGRVTAVFRDFYRVITENGEFLATLKRGNFYELSPSNLPAVGDFVEVSNEKQILSVLQRKTIFSRMTKDSEEQLIAANFDYALIVMSLNHDFNLNRLERYLTVAWDSGATPIIILTKADLVDDLTPFTMELETVAYGVPTYYVDNLSHRGFEALEADLKPNSTLVLLGSSGVGKSSFINSLAGADLMKTSEIREDDSKGKHTTTHREMHLLANGWIIIDTPGMREFGIGLNQAGLETTFSDVEELSKDCRFHDCSHTSEPGCAVQESLADGTLSLKHYENWQKLQREMAYHARKNSPALARQERDRWKTIQKSLRTHLKTRPKR

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

346 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.107 kDa

MILEQYGITSFFKEQKIAATSSYGRVTAVFRDYYRVITENEEFLASLKRGNFYELSSTSLPTVGDFVEISGDLQILSVLERKTVFSRMNKDSAEQLIAANFDYALIVMSLNHDFNLNRLERYLTVAWDSGATPIIILTKADLVEDLSFYAQQLEAVAYGVPAYYVDNLSHHGFEALESDLKPNSTLILLGSSGVGKSSFINSLAGTDLMKTAGIREDDSKGKHTTTHREMHLLSNGWIVIDTPGMREFGVGFNQAGLETTFSDVEELAEGCRFHDCSHTQEPNCAVQAALEDGTLTMQHYENWLKLQREMAYHARKNSPALARQERDRWKVIQKSMRTHFKTRPKK

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

298 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.953 kDa

MKIGQIRQSLSGFYDVYADGQMYRTRARGNFRKRRITPLVGDNVEFDAATPQEGYVLNILDRQTQLVRPPVANVDLGIVVTATTEQEFSTNLLDRQLVALAVAGIEPLLYFAKTDLLTDEVYQQRLTLADAYRQIGYQVICERTAFSPAALAAVKTALAGHVAVVMGQTGAGKSTLLNHLQPGLALATGEISQALNRGKHTTRKVSLIPIADGLVADTPGFSSYEVFDIAANELTHYFPEFVRLSVDCKYRGCVHINEPQCAVKQALAAGELLASRYDNYLQFYETIKNKKVIYNKKK

rsgA1

Small ribosomal subunit biogenesis GTPase RsgA 1

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.743 kDa

MLEGQIIKALSGFYYVFSEGKVYQCRARGNFRKRNISPLVGDDVEFQIENKTDGYILDVMSRENALVRPPVANIDIAILVFSAVEPDFSTNLADRFLVAIEKEDIKPVICISKMDLASESEKEQIAVYKDIYEAIGYDVFVTNDEPDKEAIKDYISGKTAVIAGQSGVGKSTLLNSLNSDLTLKTAEISNALGRGKHTTRHVELMPIGDGFVADTPGFSSIEWDDLQPETLQFCFPEMEDRRSGCKFRGCMHDNEPNCAVKTAVEANEIAEFRYKHYIQILQELKNRKPRY