About Products Protein Database Contact

rsfA

Gene
rsfA
Protein
Prespore-specific transcriptional regulator RsfA
Organism
Bacillus subtilis (strain 168)
Length
258 amino acids
Function
Seems to improve the efficiency of sporulation by fine-tuning the expression of genes in the sigma F regulon, particularly the timing of their expression. Negatively regulates spoIIR and its own synthesis.
Mass
29.728 kDa
Sequence
MTKQRQDAWSEENDLLLAETVLRHVREGSTQLNAFEEVGDKLNRTSAACGFRWNAVVRHQYEKALQLAKKQRKQRMRALGNGQPAKKRLLYQPPAVDPEIIQETAAEEPVKTETPSVENEQPLMSGEHMPFVDESFKEELASLSHLLSPQTPAAAPEMTMNDVIRFLQNYEGNHEQSSALKMENERLKKENQELQNKTEQLEAEVQKLEKDQKTIQEDYETLVKIMNRARKLVLFEEDEHASPSFKMDRNGNLEKLAE

Gene
rsfA
Protein
Anti-sigma-F factor antagonist RsfA
Organism
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Length
128 amino acids
Function
Positive, redox-sensitive regulator of sigma-F (SigF) activity. When reduced binds to anti-sigma-F factor RsbW (UsfX) preventing its binding to SigF, thus activating transcription (By similarity).
Similarity
Belongs to the anti-sigma-factor antagonist family.
Mass
13.589 kDa
Sequence
MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEPLVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPTTESALSAT

Gene
rsfA
Protein
Anti-sigma-F factor antagonist RsfA
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Length
128 amino acids
Function
Positive, redox-sensitive regulator of sigma-F (SigF) activity. When reduced binds to anti-sigma-F factor RsbW (UsfX) preventing its binding to SigF, thus activating transcription.
Similarity
Belongs to the anti-sigma-factor antagonist family.
Mass
13.589 kDa
Sequence
MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEPLVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPTTESALSAT