rsd

Regulator of sigma D

169 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

19.212 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEKHTPLNAKTLENFCHNLVDYLSSGHFHIYDRIIKEVEGASSPKMALTAKIHPALKNNTQTIMAFHDRYTNIEIDDDSCTEYQQALSDIGEALDARFKLEDQLIQWAAESWQAAQLADADKKSQVN

rsd

Regulator of sigma D

169 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

19.187 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEKHTPLNAKTLENFCHNLVDYLSSGHFHLYDRIIKEVEGASSPKMALTAKIHPALKNNTQTIMAFHDCYTNIEIDDDSCTEYQQALSDIGEALDARFRLEDQLIQWAAESWQAAQLADADKKSQVN

rsd

Regulator of sigma D

169 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

19.212 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEKHTPLNAKTLENFCHNLVDYLSSGHFHIYDRIIKEVEGASSPKMALTAKIHPALKNNTQTIMAFHDRYTNIEIDDDSCTEYQQALSDIGEALDARFKLEDQLIQWAAESWQAAQLADADKKSQVN

rsd

Regulator of sigma D

169 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

19.187 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEKHTPLNAKTLENFCHNLVDYLSSGHFHLYDRIIKEVEGASSPKMALTAKIHPALKNNTQTIMAFHDCYTNIEIDDDSCTEYQQALSDIGEALDARFRLEDQLIQWAAESWQAAQLADADKKSQVN

rsd

Regulator of sigma D

169 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

19.187 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEKHTPLNAKTLENFCHNLVDYLSSGHFHLYDRIIKEVEGASSPKMALTAKIHPALKNNTQTIMAFHDCYTNIEIDDDSCTEYQQALSDIGEALDARFRLEDQLIQWAAESWQAAQLADADKKSQVN

rsd

Regulator of sigma D

169 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

19.187 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEKHTPLNAKTLENFCHNLVDYLSSGHFHLYDRIIKEVEGASSPKMALTAKIHPALKNNTQTIMAFHDCYTNIEIDDDSCTEYQQALSDIGEALDARFRLEDQLIQWAAESWQAAQLADADKKSQVN

rsd

Regulator of sigma D

169 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

19.212 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEKHTPLNAKTLENFCHNLVDYLSSGHFHIYDRIIKEVEGASSPKMALTAKIHPALKNNTQTIMAFHDRYTNIEIDDDSCTEYQQALSDIGEALDARFKLEDQLIQWAAESWQAAQLADADKKSQVN

rsd

Regulator of sigma D

169 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

19.212 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEKHTPLNAKTLENFCHNLVDYLSSGHFHIYDRIIKEVEGASSPKMALTAKIHPALKNNTQTIMAFHDRYTNIEIDDDSCTEYQQALSDIGEALDARFKLEDQLIQWAAESWQAAQLADADKKSQVN

rsd

Regulator of sigma D

167 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.972 kDa

MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKGKHTPLNEKALENFCHNLVDYLSSGHFHIYDRIIKQVEGASSPKMALTTKVYPALKNNTQTIMAFHDRYTNIEIDDDSCTEFQQALSDIGEALDARFRLEDQLIQWAAESWQAAKPVIQAGQVK

rsd

Regulator of sigma D

165 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.928 kDa

MLNQLESLTERVGGSNKLVDRWLHVRKQLLVAYYNLVGIKPGKESYMRLNEKALDNFCQSLVDYLSDGHFNIYERIIREMEGTNPYLAATKLYPQLEANTQQIMDYYDSTLENAIDQDNYLEFQQALSDLGEALEGRFTLEDKLIALALDNNLKASNEDNVARPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.653 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.661 kDa

MLNQLENLTERVGGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDSSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.652 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDNFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.653 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.653 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.653 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.653 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.653 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.706 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNRLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.652 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDNFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.652 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDNFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.706 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNRLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.652 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDNFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.683 kDa

MLNQLENLMERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

162 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.653 kDa

MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQKVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.231 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLGGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLESNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.269 kDa

MLNQLDNLTERVRGSNKLVYRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDDYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKYPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.221 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDDYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKYPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.221 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDDYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKYPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.221 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDDYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKYPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.221 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDDYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKYPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.195 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDDYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.221 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDDYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKYPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.269 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKYPA

rsd

Regulator of sigma D

158 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

18.243 kDa

MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

rsd

Regulator of sigma D

153 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

17.494 kDa

MLNQLQSLTEYVGGNNALIDQWLQARKQLLVAYYHLVGIKPNKEALSLLDEEALDNFCQNLVDYLSTGHFHLYEKMLHEAATHSEQVLALSTQLDFALQNNTQQIMTFYDSHLAAAIDHDNCIEFQQALSSVGEALEERFTLEDNMIKQVYDN

rsd

Regulator of sigma D

153 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

17.581 kDa

MLNQLQSLTEYVGGNNALIDQWLQARKQLLVAYYHLVGIKPNKEALSLLDEEALDNFCQNLVDYLSTGHFHLYEKMLHEAATHSEQLLALSTQLDFALQSNTQQIMTFYDNHLATAIDHDNCLEFQQALSSVGETLEERFTLEDNMIRLVYDN

rsd

Regulator of sigma D

145 amino acids

Binds RpoD and negatively regulates RpoD-mediated transcription activation by preventing the interaction between the primary sigma factor RpoD with the catalytic core of the RNA polymerase and with promoter DNA. May be involved in replacement of the RNA polymerase sigma subunit from RpoD to RpoS during the transition from exponential growth to the stationary phase.

Belongs to the Rsd/AlgQ family.

16.27 kDa

MLNQLENLAKCVGGNNELIDQWLQARKGLLVAYYHLIGLKPNKEKHTPLDEEALDAFCHQLVDYLSAGHFLVYDSIVPEGESSSTLTYSGLQENTQQIMALYDSHLENAIDHDNYLSFQEALSGVGEALATRFVLEDKLIQQAME