RRP7

Ribosomal RNA-processing protein 7

297 amino acids

Plays an important role in the synthesis of 18S rRNA but is not required for the 5.8S and 25S pathway. Is necessary for the cleavage at site A2. Is required for efficient association of RPS27 with the pre-ribosomal particle.

Belongs to the RRP7 family.

34.47 kDa

MGIEDISAMKNGFIVVPFKLPDHKALPKSQEASLHFMFAKRHQSSNSNESDCLFLVNLPLLSNIEHMKKFVGQLCGKYDTVSHVEELLYNDEFGLHEVDLSALTSDLMSSTDVNEKRYTPRNTALLKFVDAASINNCWNALKKYSNLHAKHPNELFEWTYTTPSFTTFVNFYKPLDIDYLKEDIHTHMAIFEQREAQAQEDVQSSIVDEDGFTLVVGKNTKSLNSIRKKILNKNPLSKHENKAKPISNIDKKAKKDFYRFQVRERKKQEINQLLSKFKEDQERIKVMKAKRKFNPYT

rrp7

Ribosomal RNA-processing protein 7

238 amino acids

Plays an important role in the synthesis of 18S rRNA but is not required for the 5.8S and 25S pathway. Is necessary for the cleavage at site A2 (By similarity).

Belongs to the RRP7 family.

27.975 kDa

MDKLKEKGFVKLEIYLENKKRLHSIFLKEDTEDVEKKSLYLINVPITTTEKILKRAISQLGGRIVNIYPNISGLLKSGTHLRVKLVEPAEVKQVIKAASKKTTSLPWKFTQHTGLKRYVESYDRQFVNPRVLAESVDSYMKRVTKKEIAEKRRLFAMKNQPDEDGFVTVVRSGRAPVGRPQDAERQLEKKKDTGIHKDFYRFQLREKKKKALLDLAHKFEFDKQRIQQLKEKRQFKPY