RRP4

Exosome complex component RRP4

359 amino acids

Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and cryptic unstable transcripts (CUTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and in RNA surveillance pathways, preventing translation of aberrant mRNAs. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. RRP4 as peripheral part of the Exo-9 complex is thought to stabilize the hexameric ring of RNase PH-domain subunits.

Belongs to the RRP4 family.

39.427 kDa

MSEVITITKRNGAFQNSSNLSYNNTGISDDENDEEDIYMHDVNSASKSESDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSANNSSSIKSTGPTGAVSLNPSITRLEEESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGNGN

rrp4

Exosome complex component rrp4

329 amino acids

Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and cryptic unstable transcripts (CUTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and in RNA surveillance pathways, preventing translation of aberrant mRNAs. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. rrp4 as peripheral part of the Exo-9 complex is thought to stabilize the hexameric ring of RNase PH-domain subunits (By similarity).

Belongs to the RRP4 family.

36.688 kDa

MVTILKPEEFYVSSEADIVNDVSMTEMEDEIMEDEQMGLVDGEDVLEEFDKSIHQNLVTPGQLVTDDPQFMRGHGTYFEDGGIYASVAGSVQRVNKLISVKPLRSKYVPEIGDLIIGKIAEVQPKRWKVDIGAKQNAVLMLSSINLPGGIQRRKLETDELQMRSFFQEGDLLVAEVQQYFSDGSVSIHTRSLKYGKLRNGVFLKVPPALVVRSKSHAYALAGGVDIILSVNGYVWVSKHNENQHSSVSITRLEEEASESIYSNENDEIDGYTRLNISRVSICIKGLASRSLPLTQASITNFYESSLVFSNLQDLTVPKNMDQIAMEAMQ

RRP4

Exosome complex component RRP4 homolog

322 amino acids

Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing, maturation and degradation events. In vitro, is an active and distributive 3'->5' exonuclease requiring a free 3'-OH on the substrate and releasing nucleoside 5'-monophosphates (PubMed:11809881). Required for normal embryo development (PubMed:18160042).

Belongs to the RRP4 family.

36.574 kDa

MVMRKLQLPLSQTQKVRFERAIERLQSLSSSANSDASVIVTDSIPVNHDDAFLKGHGTSEVDGELLATVCGVVERVDKLVYVRTLRARYKPEVGDIVVGRVIEVAQKRWRVELNFNQDGVLMLSSMNMPDGIQRRRTSVDELNMRNIFVEHDVVCAEVRNFQHDGSLQLQARSQKYGKLEKGQLLKVDPYLVKRSKHHFHYVESLGIDLIIGCNGFIWVGEHVEVRDPMAIDDQKDEEMISSSSTGKEQSHIPLETRQTICRIGNAIRVLSNLGFTVTLEVIMETVNLSNSKNIDIHDMLGSEFHVVVAENEAERRRTKRKK

rrp4

Exosome complex component Rrp4

311 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

34.7 kDa

MLLVNEKDLVVPGQVLAENEYFPGRGTFKEDNRICSSFVGLVSVRNKKINVIPLQSKYIPKRGDVVIGEITDIRFSMWGLDINSPYTGLLPASEVFGKDKRELESVFDIVDVLLLRVVDVDEVKKVKLGLKGRGLGKFRDGILVYITPTKVPRLIGKRGSMINMVKEKTHCDIVVGQNGVVWIKGEPDMERIAEKVVLMIDREAHTSGLTDRVRELLDRLTGVEPEIQVEESEGTEKPETPESEDFEEASDYSEDVEVSPESEDIEEVSDESEDLEVESEDVEEGTDTPAAEEDDGEAGDAEVKDENNSER

rrp4

Exosome complex component Rrp4

298 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

33.843 kDa

MIYVENKDLVIPGEVLADDEYYSGRGTFKENGKICSSLMGLVSLRNKKIRVIPLKSKYVPKKGDVVIGKIKDVRFSMWDVDINSPYSGILPAFEVFGREKKELNKVFDVGDVLFLRVVDVDEVKKVKLGLKGRGMGKFRGGIIVDITPTKVPRLIGKKGSMINMIKDKTNCKIIVGQNGLVWVKGEEDMEQLTKDIIHMIEAEAHTSGLTNKVKNKLSLAIDGELPQEDDYSDDYEELEKPKLQNFKEELEQEEKEEQSKKDSTDFYKVIEELKKKNKKDKPLSYGNNSGNSYILNNR

rrp4

Exosome complex component Rrp4

265 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

29.315 kDa

MKRIFVQNRELVVPGTLLAQGPYKNGRGTFREGSRIYSTVIGLVDIKGNTIRVIPLEGPYIPEVGDNVIGKIVDVKFSSWVVDIGAPYPANLKIQDFTDEKIDLLRTDLRKFFDIGDIIYAKVKAITEVNNIDLTTKGMPFNGGPLKGGQIVKITPSRVPRVIGRGGSMINMIKKLTMTRIIVGQNGWIWVSGKNDALEKLAIEAILKIDKESHTRGLTDRIKALLLSRLQELKEKGVIEEIPKLEEEPQGEDEVNGNDGEARGA

rrp4

Exosome complex component Rrp4

265 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

29.649 kDa

MKRIFVQNRELVVPGTLLAQGPYKNGRGTFREGSRIYSTVIGLVDIKGNTIRVIPLEGPYIPEVGDNVIGKIVDVKFSSWVVDIGAPYLANLKIQDFTDEKIDLLRTDLRKFFDIGDIIYGKVKAITEVNNIDLTTKGMPFNGGPLKGGQIVKITPSRVPRVIGRGGSMINMIKKLTMTRIIVGQNGWIWVNGKNEALEKLAIEAILKIDRESHTKGLTDRIKSLLLSRLQELKEKGVIEEIPELEEEPQEETEVNNNDGETRRT

rrp4

Exosome complex component Rrp4

264 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

29.534 kDa

MRRIFVQNRELVVPGTLLAQGPYKNGRGTFKEGSRIYSTVIGLVDIKGNTIRVIPLEGPYIPEVGDNVLGKIVDVKFSSWTVDIGSPYSATLKIQDYTDEKIDLLRTDLRKFFDIGDIIYAKVKGINEVNNIELTTKGMPFNGGPLRGGQIIKITSSKVPRVIGKGGSMINMIKKLTQSRIIVGQNGWIWISSKNPELEKLAIEAILKIERESHTRGLTDRIKNMLLSKLQELKERGVIEEIPSLEEETQEETVMENDVEARGP

rrp4

Exosome complex component Rrp4

263 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

29.124 kDa

MDRKIVIPGQLLSEKKEMAGPGTYVKNGNIYSLLYGIANFKGRVSVVPFSGKYIPSRKDFIIVNVIDVTPSNWIMETGSPYDGLLHVSEFPKRVDSSEMRKFMDVGDCVIVRVKDVSKAMKVELSMREQGSRALSKGRIIEVVPSKVPRVIGHGGSMVSILKKESNCDVFVGKNGRIWINGKDKDMDRLTTAIEMIESESHMSGLTDKVGMFLRGEPEGTEGSDEEQLVDEEVAGVSLEDDDVTEETSRKVDVLLDNDTDETN

rrp4

Exosome complex component Rrp4

260 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

29.172 kDa

MDKKIVIPGDLLSDDVKKSGYGTYVKNDKIYSSLCGIESLKEDKVGVIPLAGAYIPSVNDVVIGVVIVVTPSNWILDIAAPYDGLLHVSEYPRRVESREMPEILDVGDSVILRVRDVDSSMKIELALRDPNLHKLRTGQIVEVEPVKVPRVIGHGGSMISMLKKETNCSIFVGQNGRIWIDGKDEDIELLSKALRKIEAEAQRSGLTDRIYNFLKNERMKEKESKPVEFLKNEKTDVSVAKEDHSEDIYRKIDVLLDPKN

rrp4

Exosome complex component Rrp4

260 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

29.136 kDa

MDKKIVIPGDLLSENQKKAGYGTYVKNDKIYSSLCGIENLKEDKVGVIPLAGAYIPSANDVVIGIVIVVTPSNWIFDIAAPYDGLLHVSEYPRRVESREMPEILNVGDSVILRVKDVDSSMKVELALRDPSLHKLKTGQIIKVESVKVPRVIGHGGSMISMLKKETNCSIFVGQNGRIWIDGKDEDIELLSKALRKIELEAQRSGLTDRIYNFLKNERIRQKESKPVGFFKNETEGVTATKEDHSEEIYRKIDVLLDPKN

rrp4

Exosome complex component Rrp4

260 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

29.288 kDa

MDKKIVIPGDLISENSKKAGYGTYVKNDKIYSLFCGIENLKEDKVGVIPLAGVYIPSANDVVIGIVIVVTPSNWIMDIASPYDGLFHVSEYPRRIESREMHEVLNVGDSIILRVKDVDNSMKVELALRDSSFHKLKTGQIVEVEPVKVPRVIGHGGSMISMLKKETNCSIFVGQNGRIWIDGKDDDVELLSKALRKIEAEAQRSGLTDRIYNFLKNERSKQKESKPAKFFKSGKKEVKLPKEDHSEEIYRKIDVLLDPNN

rrp4

Exosome complex component Rrp4

257 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

28.317 kDa

MKKIFVKPRELVVPGTLLAQGPFKNGRGTFREGNAIYSTVIGLVEIRGNVIRVIPLEGPYIPEVGDNVLGKIVDVKFSSWTVDIGAPYQASLRVQDAVEERIDLLKTDLRKIFDIGDIIYAKVKAFNEVNQIDLTTKGMPFKGGPLRGGQLVTITPSKVPRLIGKGGSMINMIKTLTGTRIIVGQNGWVWVSGKNDELERLAIEAILKVDRESHTQGLTDRVKEFLLSRLRELKEQGVIEEIPEVNGEEGGEDDGQA

rrp4

Exosome complex component Rrp4

253 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

28.512 kDa

MYEKEAISLQTSKRILVVPGDSVQISQDVVIDPQQILYLYKKDDNTFISTITALLDFENIDDKKKLRVIPLKGRYIPREGDIVIGIVVDVTLSSWIIDINSPYLSVLNASDYLGRSFNPLTDNIRKYLEIGDVVVGKIATFDRSRGPILTVQDKGLGKVVDGSLIEIEPIKVARVIGKKKSMLNMLIEQTKCDILVGNNGRIILRCPNPELEYIAILAIKKIESEAHTTGLTERIREFIIEEKVKRGLIKYEV

rrp4

Exosome complex component Rrp4

249 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

27.998 kDa

MNMSQSQKIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSGCSIFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIKQFIEEKLGERNASSGETKTNS

rrp4

Exosome complex component Rrp4

249 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

27.725 kDa

MSQANKIYFEDRSIVTPGDLIAEGEFQVPWSPYYYKVNGKYYSAITGLITVKDGSIFEVIPLESSRYYPKVGDTIIGLVEDIEIYGWVIDIKSFYSAYLPASSLLGRPISPGEDVRRYLDVGDYVIAKIEAFDRTISPVLTVKGKGLGRIPLGTVMDIMPVKVPRVIGKNRSMIEVLTSESGCEIFVAQNGRIHIKCANNLIEEALIEAINIIQSESHTKGLTERIRNFLKQKLGVIRNDSAPKTEANT

rrp4

Exosome complex component Rrp4

247 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

27.575 kDa

MSNSKIYFEDRSIVTPGDLIAEGDFQIPWSPYYYKIGNKYYSSITGLIEVKENLFEIVPLEGHRYIPKVGDTVIGLIEDVEIYGWVLDIKSPYSAYLPASSFLGRPVSPGEDLRRYLNLGDYVIAKIETYDRTINPILSIKGKGLGRVSSGIVIDIPPVKVPRVIGKNRSMLDTLTSETGCEILVAQNGRILANCATKMIEEALVEAIQIIEKESHIKGLTEKIRKFLREKLGETKNDSATKTEANT

rrp4

Exosome complex component Rrp4

247 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

27.309 kDa

MKLKVIVADRQLVRPGDILAYIEEAGEVVKFKKIPDKHVYIFDNKIISDLVGVVNVSGEDIQVIPLEGVYIPRKDDLVIGIVENVGVTAWTLDIRSPYPGVLNASEVIEGFNPLIHNLRNYLDTGDFVIGRIALFDRTRDPVITVKGKGLGKITEGVVVDVKPSKIPRLIGKRGSMYNLLTSMSGCEITIAQNGFVWLKCHDENRAKVLIQAIKLIELKAHMRGLTEEVKMFLERKLGGGGSGEHQA

rrp4

Exosome complex component Rrp4

239 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

26.914 kDa

MPEFELYVEDRQVVTPGELLARGQVIASEGTYTSGDEVYSKVTGLVDIDGRRIRVIPLAGPYRPSPGDFVVGIVEEVKFSSWLIDVRAPLPAILHVSNALEEEVDLIETDLSRYYRPGDVITAVVREVDPVQRVELSLLEDDAPTRLGRLQGGQVVEIDPVKVPRVIGRKGSMIKMLKRVLGCDIVVGANGRIYVRAREEPKKERELLAVRAIREIERRSHLRGLTDWLKANLKRLSRW

rrp4

Exosome complex component Rrp4

237 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

26.222 kDa

MRGGAVTIHVKDRQIVAPGEFVGEQGRFRVEGQVFRVGRKYYSKVLGVVTVDEENRVVKVIPLKGKYFPVEGHIVVGKVVDIGFTSWEVDINSPYVAVLPVSEVTSRPVTISRNELSRILDVGDLILAKIVSFDLSKDPVLTIKESRLGKIPRGTLVEIPPQKVPRVIGRRGSMVSMIEDLLGVKLIVGQNGRIVVVGDDPQRVEIAVLAVRKIEAEAHTTGLTDRIKQFIEERLRS

rrp4

Exosome complex component Rrp4

236 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

26.393 kDa

MYQLGDVKKIVLPGDPIEVQGKMRNGVYRGQDNRYYSEYFGTLQVNDQFVDVVPFSGQYIPRKGDKVIGKVIEVGPSTWTVDINSPYFAMLHMNDTPWRMSSGDLKRYLNAGDYIYAKIMSVNEIKESWLTLKEPGLKKLEGGHMVLIHASRVPRVIGKGGGMVNMVKELTATRIIIGQNGLIWIDGPIEGVTMAIAAIEMIEREAHTEGLTARVESFLKELKGEKDGSQQNKADQ

rrp4

Exosome complex component Rrp4

236 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

26.388 kDa

MYQLGDVKKIVLPGDPVEVQGKIRNGIYRGPDNKYYSEYFGTLQVSDQYVDVVPFSGQYIPRKGDKVIGKIIEVGPSTWTVDINSPYFAMLHMNDTPWRISSGDLKRYLNSGDYVYAKIMSVNEIKESWLTLKEPGLKKLEGGHMVLIHASRVPRVIGKGGGMVNMVKELTSTRIIIGQNGLIWIDGPIEGVTMAIAAIEMIEREAHTEGLTVRVESFLKELRGDKDGNQQDKANQ

rrp4

Exosome complex component Rrp4

235 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

26.075 kDa

MYYVTPRQLVFPGDVIATADSKVEGPVYLDNGKYRSLVVGLVEFREDVVVVVPLEGTYKPKKGDLVIGYVTDVLATGWEVDVRSFMPAYLPVGEALHRHVDLETTPLTTFLNIGDVVVAKVKDVDLTDEYPIILTLKDEKVGKVESGTVVEITPVKVPRVIGKRGSMLNTLMELGCDIVVGQNGRIWVKCKDPRDEVFLASLIRKIEAESHVMGLTDRIRAEIENYKTSKQQGTV

rrp4

Exosome complex component Rrp4

235 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

26.061 kDa

MSSERQLAGRIVVPGEPLPEEVEASPPYVIDYKGVKRATVVGLLREKGDGGGRAFVKLKEIYVPQAGDVVIGLIQSVGIMNWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDYIKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVPRVIGRKMSMLKTLEEKTECKIFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIREV

rrp4

Exosome complex component Rrp4

230 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

26.139 kDa

MEIRQIVYPGEKIDLEGQKPRNGLYEENDEYYSEYFGVVQKSDKFIDIVPFNGPYMPRINDKVIGKVIDVSATMWTVDINSPYFSLMHMNDTPWHVTSGDLRKYLNVGDYIYAKVSILNEIKESWLSLKDVNLRKLEEGSIIYIKAPKVPRVIGKAGNMINMIKSETNTKIIVGQNGLIWIDGEPENVDLAINAIGMVEKEAHTFGLTDRVKAYLDKMKGGNNGRSEVNQ

rrp4

Exosome complex component Rrp4

228 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

24.944 kDa

MSEVTLLVRDKEVVIPGQPLARGKVKPGKDVYVDESGTIRSKKLGLVSLKDDEISIVPLVGAYIPKEDDLVIGIVSKISGNTILVDIRSPYQGALPIQRRAERVDLKKYDLKIGDVILAKVRSFDGASSLILTIDAEGLGKLEGGYLLEVDPAKVPRVIGKRQSMLSMLKEATRSEIIVANNGRIWVKPPSVKELIVLEKALKKIEEESHVSGLSDRISSLLSQELSR

rrp4

Exosome complex component Rrp4

226 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

24.669 kDa

MADKRKYVIPGDVVTTGPFRPEQNTVLEGNKIISTTIGISEIYDDSVRVIPLTGKYIPKINDLVIGKVNSHTSLSWELDINSCYVGFLPAQDVFGRDFSAHADELATKLRTGDLVAARIANFDRTRDPLVSISDRDLGKIDSGVLMEISPSKVPRLIGKKGSMIQMIEEATDAAVTIGQNGWVVVSCESPEGLLKAKKAIQMVNEQAHVANLTDQVKEMLDKKGES

rrp4

Exosome complex component Rrp4

223 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome (Probable).

Belongs to the RRP4 family.

24.725 kDa

MRKIVLPGDLLSTNPRAAGYGTYVEGGKVYAKIIGLFDQTETHVRVIPLKGRYTPSVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSENPEMKPNKKPNEVLDIGDAIIAKVLNIDPKMKVTLTMKDRICRPIRFGRIVAINPARVPRVIGKKGSMIKLLKSELDVQIVVGQNGLIWVNGDRRKVSIAEEAIYLIEQEAHTEGLTDRVAEFIKRRKADVGIQ

rrp4

Exosome complex component Rrp4

222 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

24.771 kDa

MLFVKERDIVVPGEKLAGNDYIAGRGTFIEEDKIYSSVVGLVSIKGKRIEVIPLQGKYIPKKNDSVIGKVVDVKFARWIVDIRSPYSAILPVSEVIDKGKKNLEEIFGIGDTLFLKIIEVDEVKKVKLGLHEGGPIKLEGGTLAYITPSKVPRVIGRKGSMIKMLKKLTNCEILLGQNGVIWVKGDKKMEEIVKRALEMIDREAHTSGLTDRVKEFIIRSIE

rrp4

Exosome complex component Rrp4

222 amino acids

Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome.

Belongs to the RRP4 family.

25.421 kDa

MIFVENKEIVLPGSLLTDNNYKLGRGTYKENGKIYSSITGLVYFESEQIKVIPLKDTYSPNYGDLVIGRVTGSSYSSWSIDINSTYHGFLPTTELYDKNEPNINNIINIKDMLLLRVANVDEINRVKLTLRSRGLGKFNQGTIIKVKQPTIHFLSEENAFLTTMIQEYTYTDVIIGKNGLIWINGLKENIERIIEIIELIEKEEPLKHNLIKHIQSMILNPK