rps12-A

30S ribosomal protein S12, chloroplastic

126 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

14.039 kDa

MPTINQLIRNTRQSIRNVKKSPALQGCPQRRGICTRVYTINPKKPNSATRKVARVRLTSGFEITAYIPGIGHNSQEHSSVLVRGGRVPDLPGVKYHIVRGTLDAVGVKDRQQGRSKYGVKKPKKKK

rps12-A

Plastid 30S ribosomal protein S12

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.861 kDa

MPTIKQLIRKKRQPNLNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGIEITAYIPGIGHNLQEHSSVLVRGGRVKDLPGVRYHIIRGTLDAVGVKDRQQGRSKYGVKIKNK

rps12-A

30S ribosomal protein S12, chloroplastic

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.82 kDa

MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGALDAVAVKNRQQGRSKYGVKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.82 kDa

MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGALDAVAVKNRQQGRSKYGVKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.82 kDa

MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGALDAVAVKNRQQGRSKYGVKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.864 kDa

MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGVKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.822 kDa

MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGAKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.864 kDa

MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGVKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.822 kDa

MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGAKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

124 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.822 kDa

MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGAKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.738 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.795 kDa

MPTIKQLIRNTRQKIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.736 kDa

MPTIKQLIRNTRQPIKNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.639 kDa

MPTIKQLIRNTRQPIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.655 kDa

MPTIKQLIRNARQLIRNVTKSPTLGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.609 kDa

MPTIKQLIRNARQPIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.771 kDa

MSTIQQLIRNTRQPIEDRTKSPALRGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRKQGRSQYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.795 kDa

MPTIKQLIRNTRQQIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.75 kDa

MPTINQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.738 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.738 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.734 kDa

MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.734 kDa

MPTIKQLIRNARQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.782 kDa

MPTIKQLIRNTRQPMRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.738 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.722 kDa

MPTSNQLLRNSRQPVRKTKKTPALRGCPQRRGRCSKVYIINPKKPNSGNRKVARVRLTSGFEITAYIPGVGHNVQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAAGVKDRKQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.708 kDa

MPTIKQLIRNARQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.726 kDa

MPTMKQLIRNTRQPIRNVTKSPALQGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGAKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.75 kDa

MPTIKQLIRNTRQPVRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.639 kDa

MPTIKQLIRNTRQPIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.768 kDa

MPTMKQLIRKTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGAKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.736 kDa

MPTIKQLIRNTRQPIKNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.708 kDa

MPTIKQLIRNTRQPIKNVTKSPALRGCPQRKGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.782 kDa

MPTIKQLIRNTRQPMRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12-A, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12-A, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.639 kDa

MPTIKQLIRNTRQPIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.738 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIQQLIRNARQPIRSRTKSPALRGCPQRRGVCIRVYTTTPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVSVRGGRVKDLPGVRYHIVRGTLDAVGVKDRKQGRSRYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.736 kDa

MPTIKQLIRNTRQPIKNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.738 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.738 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.738 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.754 kDa

MPTMKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGAKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

Component of the chloroplast ribosome (chloro-ribosome), a dedicated translation machinery responsible for the synthesis of chloroplast genome-encoded proteins, including proteins of the transcription and translation machinery and components of the photosynthetic apparatus.

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

123 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.764 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK

rps12-A

30S ribosomal protein S12, chloroplastic

122 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.676 kDa

MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYNPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRLQYGVKKPKK

rps12-A

30S ribosomal protein S12, chloroplastic

118 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.08 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSSAL

rps12-A

30S ribosomal protein S12, chloroplastic

118 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.08 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSSAL

rps12-A

30S ribosomal protein S12, chloroplastic

118 amino acids

With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits (By similarity).

Belongs to the universal ribosomal protein uS12 family.

13.08 kDa

MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSSAL