rpoN

RNA polymerase sigma-54 factor

520 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes (nif operon), GlnA and DctA for dicarboxylate transport. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator proteins NifA, NtrC, or DctD for the expression of the regulated proteins (By similarity).

Belongs to the sigma-54 factor family.

57.478 kDa

MALSANLFLRQSQSLVMTPQLMQSIQLLQMTHFELNQFIAQEVEKNPLLEFPSNDGEAGDERGAGEDEPFGQPSEDAGSDDGADSRAEALSSDWYDNGGSESTGRLNDELDANYTNVFPDDGGPQRLDAPELVGQWKSMPGSAEGADYDLDDFVAGQLSLRDHLAQQIPFVLPDMTDRLIAQNFVDQLDDAGYLQTDLVETGERLGTSLEQVEHVLAALQTLDPPGVFARSLAECLAIQLRQKDRYDPAMQALVANLELLARRDFATLKRLCGVDEEDLLDMLGEIRQLNPKPGGGFEAGVSEAIMPDVVVRPSADGGWLVELNPDTLPRVLVNQSYFSRVTRNGEDHAFLSECLQSANWLTRTLDQRAKTIMKVASEIVRQQDAFLLNGVDHLRPLNLKTVAEAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSISAVEGGEQHSAEAVRATRFRALIMQESPDAVLSDDDIVDMLKKGGIDLARRTVAKYREAMNIASSVQRRREKRALAKVAGF

rpoN

RNA polymerase sigma-54 factor

519 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes (nif operon), glnA and dctA for dicarboxylate transport. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator proteins NifA, NtrC, or DctD for the expression of the regulated proteins.

Belongs to the sigma-54 factor family.

57.196 kDa

MALSASLHLRQSQSLVMTPQLMQSIQLLQMTHLELGQFIAQEVEKNPLLEFQSADEAGFGSDRPERDETGLTAEAGGAEESVDHGDLYDSATTSPGERLSTELDADFANVFQDDTAPQRADAPELLGQWKSMPGAGGSNDGEGYDLDDFVAGRKTLRETLIEQVAFAFAAPADRLIAQHLIDQLDEAGYLHAEIAETAARLGASAADVTRVLLVLQQFDPPGVFARTLSECLAIQLRLRNRLDPAMEALVANLELLARRDFASLKKICGVDEEDLIEMLAEIRKLDPKPGTSFETSVTEAIIPDVVVRSAPDGGWLVELNPDALPRVLVNHDYFAEISRHSQKNSAEQAFLSECMQNANWLTRSLDQRARTILKVASEIVRQQDAFLVHGVDHLRPLNLRIVADAIKMHESTVSRVTSNKYILTPRGLFELKYFFTVSIGSAENGDAHSAESVRHRIRTMISQESADAVLSDDDIVDILKRAGVDIARRTVAKYREAMNIPSSVQRRREKRALAKAAGF

rpoN

RNA polymerase sigma-54 factor

514 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes.

Belongs to the sigma-54 factor family.

55.888 kDa

MAMSPKMEFRQSQSLVMTPQLMQAIKLLQLSNLELVAYVEAELERNPLLERASEPESPEHDPPNPQEEAPTPPDSGAPVSGDWMESDMGSSREAIETRLDTDLGNVFPDDAPAERIGAGSGSGSSIEWGSGGDRGEDYNPEAFLAAETTLADHLEAQLSVAEPDPARRLIGLNLIGLIDETGYFSGDLDAVAEQLGATHDQVADVLRVIQSFEPSGVGARSLSECLALQLRDKDRCDPAMQALLDNLELLARHDRNALKRICGVDAEDLADMIGEIRRLDPKPGLAYGGGVVHPLVPDVFVREGSDGSWIVELNSETLPRVLVNQTYHATVAKAARSAEEKTFLADCLQSASWLTRSLDQRARTILKVASEIVRQQDAFLVHGVRHLRPLNLRTVADAIGMHESTVSRVTSNKYISTPRGVLEMKFFFSSSIASSGGGEAHAAEAVRHRIKSLIEAESADDVLSDDTLVQKLKDDGIDIARRTVAKYRESMNIPSSVQRRREKQALRSDAAAAG

rpoN

RNA polymerase sigma-54 factor

514 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes (nif operon), glnA and dctA for dicarboxylate transport. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator proteins NifA, NtrC, or DctD for the expression of the regulated proteins.

Belongs to the sigma-54 factor family.

56.679 kDa

MALSASLHLRQSQSLVMTPQLMQSIQLLQMNHLELSHFIAQEVEKNPLLEVQPADEPTISDREDAGPHPAETGGETDEAAGQSDLYDSAMSRSGERLSEGLDADFANVFPDDTAPQRADAPELLGQWKSMPGAGDAEGYDLDDFVGGRKTLRETLAEQLPFALSAVSDRLIARYFIDQLDDAGYLHADLAETAETLGAAGEDVARVLHVLQQFDPPGVFARTLGECLAIQLRARNRLDPAMEALVANLELLARRDFASLKKICGVDEEDLIDMLAEIRKLDPKPGTSFETGVFEAIIPDVVVRAAPDGGWLVELNPDALPRVLVNHDYFTEISRSSRKNSGEQAFLNECLQNANWLTRSLDQRARTIMKVASEIVRQQDAFLIHGVGHLRPLNLRIVADAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSIGSAENGDAHSAESVRHRIRTMINQESADAVLSDDDIVDVLKQAGVDIARRTVAKYREAMSIPSSVQRRREKRALAKAAGF

rpoN

RNA polymerase sigma-54 factor

513 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes (nif operon), glnA and dctA for dicarboxylate transport. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator proteins NifA, NtrC, or DctD for the expression of the regulated proteins.

Belongs to the sigma-54 factor family.

56.822 kDa

MALSASLHLRQSQSLVMTPQLMQSIQLLQMNHLELTQFIAQEIEKNPLLEVQSPSDEASTAERGDSGPQPEEAGSEIDEGAGEGDVYDSATSRSGERLSDGLDSDFANVFPDDTTPQRADAPELLGQWKSMPGASDGESYDLDDFVASRKTLREALIEQLPFALESGSHRLIAQYLIDQLDDAGYLHADLAETAQRLASASEDVTRVLDVLQQFDPPGVFARTLGECLGLQLRARNRLDPAMEALVGNLDLLARRDFASLKKICGVDEEDLIDMFAEIRKLDPKPGTSFETGSFETIIPDAVVRTAPDGGWLVELNPDALPRVLVNHEYFAEISRSCRKSSGEQIFLNECLQNANWLTRSLDQRARTIMKVASEIVRQQDAFLMHGVGHLRPLNLRTVADAIKMHESTVSRVTSNKYMLTPRGLYELKYFFTASIGSAENGDAHSAESVRHRIRTMVNQESADAVLSDDDIVDILKKAGVDIARRTVAKYREAMHIPSCVQRRREKRALARVG

rpoN

RNA polymerase sigma-54 factor

502 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein NifA for the expression of the nitrogen fixation proteins.

Belongs to the sigma-54 factor family.

56.917 kDa

MKPSLVLKMGQQLTMTPQLQQAIRLLQLSTLDLQQEIQEALDSNPMLERQEDAEDYDSPDMLGEHGDQSTLDTTPGSYQEGYESGAASEDGGTLEEGDWHERIPSELPVDTAWEDIYQTSASNLPSTDEDEWDFTTRTSTGESLQSHLLWQLNLTPMSDTDRLIAVTLIDSINSDGYLEAALEEILASLDPELGVELDEVEMVLRRIQQFEPAGIAARDLSESLLLQLRQLPPDTPWLEEAKRLAKDYLDLLGNRDFTQLMRRMKLKEEELRPVIELIQSLNPRPGAQIESSEPEYVVPDVIVRKHNDRWLVELNQEAVPRLRINPHYAGFIRRADASADNTFMRNQLQEARWFIKSLQSRNETLMKVSTQIVEHQRGFLDYGEEAMKPLVLHDIAEAVGMHESTISRVTTQKYMHTPRGIYELKYFFSSHVSTAEGGECSSTAIRAIIKKLIAAENPKKPLSDSKIAGLLEEQGIQVARRTVAKYRESLSIAPSSERKRLM

rpoN

RNA polymerase sigma-54 factor

497 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes. This sigma factor is required for the de novo biogenesis of both flagellum and stalk, and for polar morphogenesis and normal cell division. It may not be involved in nitrogen assimilation.

Belongs to the sigma-54 factor family.

54.457 kDa

MALSHRLELRQGQGLVITPQLQQAIKLLQLSNIELDAFVEAELERNPLLQRDEGDHEPAVEVEAERDASLTQVDAVADTTAGRELDTPVDDVSPGERATGEGTDAEHAGGQIDWSRAGGGGSFESDEGYERALTDSPTLAAHLRTQLVQAALSPAHNAIAEILIDAVDEGGYLRLDIVELADRLGCALALVEETLSVLQGFEPVGVFARDVRECLALQLKDLNRYDPAMAAMLDHLELLAKRDMAGLRRICGVDDEDLREMIGEIRSLNPRPGAAYHSEPAETLVPDVMVREGLGGMWHVELNTDTLPRVLVDQRYHARVSKGARSDQEKTFVADCMASANWLVKSLDQRAKTILKVASEIVRQQDGFLAFGVEHLRPLNLKTVADAIGMHESTVSRVTSNKYIATPRGVFELKFFFTSAIQSSEGGEAHSAASVRHKIKGLVDAEKCEADVHSDDRIVEILKAAGVDIARRTVAKYREAMRIPSSVERRRLMKEAV

rpoN

RNA polymerase sigma-54 factor

497 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-54 factor family.

56.054 kDa

MKPSLVLKMGQQLTMTPQLQQAIRLLQLSTLDLQQEIQEALESNPMLERQEDGDDFDNSDPLADGAEQAASAPQESPLQESATPSVESLDDDQWSERIPSELPVDTAWEDIYQTSASSLPSNDDDEWDFTARTSSGESLHSHLLWQVNLAPMSDTDRMIAVTIIDSINNDGYLEESLEEILAAIDPELDVELDEVEVVLRRIQQLEPAGIGARNLRECLLLQLRQLPSTTPWLNEALRLVSDYLDLLGGRDYSQLMRRMKLKEDELRQVIELIQCLHPRPGSQIESSEAEYIVPDVIVRKDNERWLVELNQEAMPRLRVNATYAGMVRRADSSADNTFMRNQLQEARWFIKSLQSRNETLMKVATQIVEHQRGFLDYGEEAMKPLVLHDIAEAVGMHESTISRVTTQKYMHTPRGIFELKYFFSSHVSTAEGGECSSTAIRAIIKKLVAAENAKKPLSDSKIAGLLEAQGIQVARRTVAKYRESLGIAPSSERKRLV

rpoN

RNA polymerase sigma-54 factor

497 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the xylCAB operon and the xylS gene. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein XylR for the expression of the xylCAB operon and xylS.

Belongs to the sigma-54 factor family.

56.215 kDa

MKPSLVLKMGQQLTMTPQLQQAIRLLQLSTLDLQQEIQEALESNPMLERQEDGEDFDNSDPMADNAENKPAAEVQDNSFQESTVSADNLEDGEWSERIPNELPVDTAWEDIYQTSASSLPSNDDDEWDFTTRTSAGESLQSHLLWQLNLAPMSDTDRLIAVTLIDSINGQGYLEDTLEEICAGFDPELDIELDEVEAVLHRIQQFEPAGVGARNLGECLLLQLRQLPATTPWMTEAKRLVTDFIDLLGSRDYSQLMRRMKIKEDELRQVIELVQSLNPRPGSQIESSEPEYVVPDVIVRKDSDRWLVELNQEAIPRLRVNPQYAGFVRRADTSADNTFMRNQLQEARWFIKSLQSRNETLMKVATQIVEHQRGFLDHGDEAMKPLVLHDIAEAVGMHESTISRVTTQKYMHTPRGIYELKYFFSSHVSTSEGGECSSTAIRAIIKKLVAAENQKKPLSDSKIAGLLEAQGIQVARRTVAKYRESLGIAPSSERKRLM

rpoN

RNA polymerase sigma-54 factor

497 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the xylCAB operon and the xylS gene. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein XylR for the expression of the xylCAB operon and xylS.

Belongs to the sigma-54 factor family.

56.215 kDa

MKPSLVLKMGQQLTMTPQLQQAIRLLQLSTLDLQQEIQEALESNPMLERQEDGEDFDNSDPMADNAENKPAAEVQDNSFQESTVSADNLEDGEWSERIPNELPVDTAWEDIYQTSASSLPSNDDDEWDFTTRTSAGESLQSHLLWQLNLAPMSDTDRLIAVTLIDSINGQGYLEDTLEEICAGFDPELDIELDEVEAVLHRIQQFEPAGVGARNLGECLLLQLRQLPATTPWMTEAKRLVTDFIDLLGSRDYSQLMRRMKIKEDELRQVIELVQSLNPRPGSQIESSEPEYVVPDVIVRKDSDRWLVELNQEAIPRLRVNPQYAGFVRRADTSADNTFMRNQLQEARWFIKSLQSRNETLMKVATQIVEHQRGFLDHGDEAMKPLVLHDIAEAVGMHESTISRVTTQKYMHTPRGIYELKYFFSSHVSTSEGGECSSTAIRAIIKKLVAAENQKKPLSDSKIAGLLEAQGIQVARRTVAKYRESLGIAPSSERKRLM

rpoN

RNA polymerase sigma-54 factor

493 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-54 factor family.

54.77 kDa

MKPSLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVEQALTENPLLERENDWIESPLRVAADGSVNLQSAPAPAPAEPQGNGEARADGAADDDSYGDSGNGDDYGSSDWSLDDFARRPQGDEDEKTPMQLREAEPTLREYLMEQLTPLKISARDKGLAIFLIESLDDDGYLSASLEEICTELPEELEFEIEEVHAILTLLQSFDPPGVGARNAAECLALQLRRLTHPQRELALNIVTNHLELLAVRDYTRLKKALQVDEAALKSAHELIRSLAPYPGHAYSRPEADFVVPDVFVRKGGGGWIAQLNPDVMPRLRINDMYAQILRGAKGESGTAGLQQKLQEARWLIKNIQQRFDKILRVSQAIVERQKNFFSHGEIAMRPLVLREIADTLGLHESTISRVTTNKYMATPMGTFELKYFFGSHVSTETGGAASSTAIRALIKQLIGAEDPRNPLSDSRIAELLGEQGFVVARRTVAKYREALKIPAVNLRKSL

rpoN

RNA polymerase sigma-54 factor

492 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor recognizes a DNA element, designated as region A upstream of the pressure-regulated operon.

Belongs to the sigma-54 factor family.

55.36 kDa

MKASLQLKMGQQLTMTPQLQQAIRLLQLSSLELQQEIQQALDSNPLLELDEEQVDPPVNGEDKTVDTEDFSATAESDGPIDNSAVETSEAITRDSMPEELPMDTTWDEVYTASPNSTSGAMRDDDMPFQGETSEGLYEHLEWQKNLTPFSDNDLAIATAIIEAIDERGYLTQSIEDILEAMGDPEIEQDEIEAVLKRIQHFDPIGIAARDLSECLLIQLAQYADTTPHIDNARILIRDHLDLIAGRDFRLLMRKTKLKEDALRDAIELIQTLNPRPGLAVTPGKDEYVIPDVTVTKKKGRWMVELNPDNMPKISVNQHYASMAKSTKSQADSQFIRGHLQEAKWFIKSLESRNETLLKVSKCIVKFQQGFFEFGEEAMKPMVLNDIAEAVEMHESTISRVTTQKYMHTPRGIFELKYFFSSHVATDDGGECSSTAIRAFIKKLVAAENQQKPLSDSKMALLLADQGIKVARRTIAKYREAMLIPPSNQRKSL

rpoN

RNA polymerase sigma-54 factor

486 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-54 factor family.

54.642 kDa

MKPSLQLKLGQQLAMTPQLQQAIRLLQLSTLELQQEIQEALESNPLLDVEEAYEENATADVHSINEEKEASAEVLDIEPQDSSDLIEKSEISSELEIDTTWDDVYSANTGSTGIALDDDMPVYQGETTQTLQDYLLWQLDLTPFSDTDRSIALALIDAIDDYGYLTVSLDDILESFADENIELDEIEAVRKRVQQFDPLGVASVNLQDCLLLQLATYPASTPWLEEAKQLLIQHIDLLGNRDYKLIIKETKLKEEDLREVLQLIQQLDPRPGNNISTEHAEYVVPDVSVYKDHGKWVVTINPDSVPKLKINQQYAALGKGNSADSNYIRSNLQEAKWLIKSLESRNETLLKVAKCIVEHQRDFFEYGEEAMKPMVLNDVALAVEMHESTISRVTTQKYMHTPRGIFELKYFFSSHVSTDSGGECSSTAIRALIKKLVAAENTAKPLSDSKIADLLADQGIQVARRTIAKYRESLGIAPSSQRKRLL

rpoN

RNA polymerase sigma-54 factor

482 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-54 factor family.

54.901 kDa

MKLSVGLKVANSLSLTPQLQQAIRLLQLSSLELEQEIQIQLDSNPLLEKVEEETHESPENVKQEQQEYELSDSLNANHLPDELPVDTDWDDVYTHQSTAMERPEFEDREDNRHSEASLKEHMLGQVNLLHFSPVDKLIAYCIVDALDEKGFLAADIEEIVSSVQHLLQQMDYDIEVEEDEVLVVLKHIQRLEPIGIGARSLAECLFVQIEALATTTLFRKEALMLLKHYELLVSNDLNKLIKQTGLNAELLKSAIDLLKTLKPYPGAEFEQKESDYQIPDVMVSKKNDHWYVQLNPDILPKLRINSFYSGMIKRADQSDDNQYLRNQMLEAKNFIKSVDERHKTLLKVASCIVQHQREFLEIGAEGMKPLVLRDVAEEVELHESTVSRVTTNKFLLTPRGLFELKYFFSSHVGTTSGGEASSTAIRAKIKKLVADENPRKPLSDNTIANLLKEEGIDVARRTVAKYRESLHIPSSSDRKVLI

rpoN

RNA polymerase sigma-54 factor

479 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen utilization genes.

Belongs to the sigma-54 factor family.

52.217 kDa

MKARLQTSLGQQLVMTPQLRQAIKLLQMSTTELEVEIAEAVETNPLLEWADEAAHAASDIAVDSSPSASTEQPQREEVAPAERDEDWSQDELQWTGSGSGGSFDDDESGDAAERVAESETLADHLLWQLHLSPLSPRDRQIGAMLIDALDEDGYLREPLSAILETLALGAAVDEADVLTVLHQIQRFDPVGVGARTLGECLALQLGVLDADTPGRELALQIVAGPLERLPRSGVAGLAHELKRSTADVEQAVQLVRSLDPRPGKQIGDLSQDTYVVPDCVIWRQRGVWRAALAGRAQPKVTIHRGYENLIRSCGESDAGYLRGQLQEARWLLKSLEARGETLLRVVRCLLEHQAGFLEFGAQALRPLTLREIAGELGLHESTISRAIARKYVRTPRGTIALRAFFASGIDTDSGGEASSTAIQAMIRRLIDAENPRKPLSDAKLADLLKTSGVPVARRTVAKYREAMNISASHERVRIA

rpoN

RNA polymerase sigma-54 factor

477 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of enzymes involved in arginine catabolism. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for the receipt of the melting signal from the remotely bound activator protein GlnG(NtrC).

Belongs to the sigma-54 factor family.

53.99 kDa

MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNPLLEQIDTHEEIDTRETQDSETLDTADALEQKEMPEELPLDASWDTIYTAGTPSGTSGDYIDDELPVYQGETTQTLQDYLMWQVELTPFSDTDRAIATSIVDAVDETGYLTVPLEDILESIGDEEIDIDEVEAVLKRIQRFDPVGVAAKDLRDCLLIQLSQFDKTTPWLEEARLIISDHLDLLANHDFRTLMRVTRLKEDVLKEAVNLIQSLDPRPGQSIQTGEPEYVIPDVLVRKHNGHWTVELNSDSIPRLQINQHYASMCNNARNDGDSQFIRSNLQDAKWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGIFELKYFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLV

rpoN

RNA polymerase sigma-54 factor

477 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein NifA for the expression of the nitrogen fixation proteins.

Belongs to the sigma-54 factor family.

53.927 kDa

MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALDSNPLLEQTDLHDEVETKEAEDRESLDTVDALEQKEMPEELPLDASWDEIYTAGTPSGNGVDYQDDELPVYQGETTQSLQDYLMWQVELTPFTDTDRAIATSIVDAVDDTGYLTISVEDIVESIGDDEIGLEEVEAVLKRIQRFDPVGVAAKDLRDCLLVQLSQFAKETPWIEEARLIISDHLDLLANHDFRSLMRVTRLKEEVLKEAVNLIQSLDPRPGQSIQTGEPEYVIPDVLVRKVNDRWVVELNSDSLPRLKINQQYAAMGNSTRNDADGQFIRSNLQEARWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEFMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGIFELKYFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAKPLSDSKLTTMLSDQGIMVARRTVAKYRESLSIPPSNQRKQLV

rpoN

RNA polymerase sigma-54 factor

477 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of enzymes involved in arginine catabolism. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for the receipt of the melting signal from the remotely bound activator protein GlnG(NtrC).

Belongs to the sigma-54 factor family.

53.988 kDa

MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALENNPLLEQTDLHDEIDTQQPQDNDPLDTADALEQKEMPEELPLDASWDEIYTAGTPSGPSGDYIDDELPVYQGETTQSLQDYLMWQVELTPFSDTDRAIATSIVDAVDDTGYLTVSLDEIRESMGDVEVDLDEVEAVLKRIQRFDPVGVAAKDLRDCLLIQLSQFDKSTPWLEEARLIICDHLDLLANHDFRTLMRVTRLKEEVLKEAVNLIQSLDPRPGQSIQTGEPEYVIPDVLVRKHNGRWTVELNSDSIPRLQINQHYAAMCNSARNDADSQFIRSNLQDAKWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGIFELKYFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLV

rpoN

RNA polymerase sigma-54 factor

475 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-54 factor family.

54.28 kDa

MQQLVQQQRLVLNQRLVHGLCLLQLSRGDLKTEVLRAVQRNPLLEIRPSSARRTGKACYLSLGDRRERMRARDRFQQLLENQPDKQVDNIRAVLREQVFYQKHEAIVLDLACAFIQMLDDHGFFSISPAIFQNMCGSMPTALQEKIPQAIALIQRLEPQGCAVFNFKESLAVQARLRFERFSDPLYRCVINLLTHHSELLFCSDNMCDGRVSVHALTTQINSMGLCVQKVSSNDVKDILLLIKELHPFPGKCVSNAQRADTNMLLEPDVLITKTAHGFVTQINCTGIPTVVFRNDYCMHSKAAEKNHALKACMHDALSLVSMLSYRERTLLDIAKTIVHYQCGFFDHGPAKLTPLRMTDVAHRTGLSVSTVSRIVRDKWLQYGSQHFSLRYFFSPRVLSTEEYRDRSSLGQNYPSSPHSKVSVKYRISRLIQEVRTQRISLSDRRIAQLLGEQGIKCARRTVNKYRSELRTCSSS

rpoN

RNA polymerase sigma-54 factor

475 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein NifA for the expression of the nitrogen fixation proteins.

Belongs to the sigma-54 factor family.

52.928 kDa

MKQGLELKLGQHLAMTPQLQQAIRLLQLSTVDLQQEVQGMLESNPLLDEETGDEGGGGPIPETVELPSEERQLDLAAENILPDELPVDSQWDDIFDMGTSGSGNGSDEDLPDFESRNSRTQSLQDYLRWQADMTHFTADERNMAELIIDAIDERGYLADSLEDLAATMNVQEDALLAVLLRVQDFDPPGVGARNLSECLLLQLKQMVEKDDAHVLLAQRIVKDHLQALGRHDYPRLCTVLGVDEAALRAAMALISALNPKPGEDVGTESTEYVIPDVIVRWAGSRLRTDLNPEAMPKLRINRHYADMAGGKDAAHKYIQDQLNEARWFIKSLQSRQDTILKVARAIVERQKDFFANGPESMRPMVLRHIADAVEMHESTVSRVTNQKYMITPRGLYEFKYFFSSHVGTDSGGSASATAIRALLIKMTQAEDAQHPLSDAEIARVLADQGIQIARRTVAKYREAANVPPASQRRRL

rpoN

Putative RNA polymerase sigma-54 factor

453 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-54 factor family.

53.029 kDa

MDFALNLTQEQRLAMTQEMQLSIKLLQMSSFELQEYVEKELQENPVLDIKESNVDKVEKDKLEYKEIIKNLDFDNYSHHSYDRNPDEEVSPFNFISEEKSLKEYLKDQIRDLDENQCIKTICLYIIENIDDRGYLILENEEIEEELKISKELAAYCVDLIHSLEPHGIGARNLAECLKIQIKQKDMDEENIFIMIDKYLEFIAENKYNVIAKELNIDVKQAQEYGDLIKTLSPKPSRGFYTGESVRYISPDAYIKKIDSEYFIIMNDDLTPRLTINAIYKDIINNDTDKDAVSYVKEKLNSALFLIKSIQHRKSTIYRVLEKIVEIQKDYFDYGESYLKPMTLKEIASSMDMHESTVSRAIRDKYIHINRGIVKIKDLFTTGMAASFSEENVSSLIIKNSIKKMIDNEDRKKPLSDQKICDLINEEGMNISRRTVAKYREEMGIKSSKGRKRF

rpoN

RNA polymerase sigma-54 factor

434 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein NifA for the expression of the nitrogen fixation proteins.

Belongs to the sigma-54 factor family.

47.871 kDa

MDMMQFQRQTTQLAMTQRMQESLRILQMSNADLADYLTAQALENPCLEVRVPEGASVAPALPSRGIQAGLDRDAFATVEGQPPSLLAHVEAQIDLAFFDPGDRRTALAFAEALEPSGWLGQPVSEVAAAAEVEEEEALVILERLQALEPAGLFARSLAECLALQLEDLGLLTWELRTMLDHLPLLAEGRIADLARRCDCEPEHIRENLALIRSLSPKPGEAFAADRTPIQPPDVRVLRGPEGWEVELTRAQLPRIRVSEAGDTGDRQADAWLARARSQARWLERAVERRQATLLRTAVCLVRHQADFLDQGPRALRPLSMEEVALELDLHPSTISRATATRLIETPRGLIPLRAFFSRSVSSDGPEAPQSQDALMALVREIIAREDRTKPFSDDAIVKQAKLAGAVLARRTVTKYRETLGIPSSYDRKRAAAAA

rpoN

RNA polymerase sigma-54 factor

428 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein nifA for the expression of the nitrogen fixation proteins.

Belongs to the sigma-54 factor family.

46.385 kDa

MELAQTLSQRQTMQMAGQMLHSLAILGMSSQDLSEHLTEQATSNPFLTYRAPPAFIARGGEDFDAVAAVAAHKPSLMAHVVDQIEMAFTETPDRLLALRFAEALEPSGWLGQSLDSIALAAGVSLSRAESMLAVLQGFEPTGLFARDLSDCLILQAREADILTWEVETLIRNIRLIAENRLSDLADLCDCDIGDIPEIIKQIRHLNPKPGLAFDHQPTPVFPPDLIAVRGAEGWTVELNRATSPTITVREDRFADGTADAKARAERRKALAEARALAQALERRGDTLLRTAAVLVARQSAFLDKGPAHLVPLTLEDVASELGLHASTISRAVSGRMIQTQTRALPLRAFFSRAVSTQGGGEAVSRDSALDFVQRTVGGEDPQNPLSDDAIVTLAERAGLRIARRTVAKYRSTLGLASSYERRRAAAAR

rpoN

RNA polymerase sigma-54 factor

426 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the nitrogen fixation genes. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein nifA for the expression of the nitrogen fixation proteins.

Belongs to the sigma-54 factor family.

46.23 kDa

MELAQTLSQRQTMQMAGQMLHSLAILGMSSQDLSEHLTEQATSNPFLTYRAPPAFIARGGEDFDAVGAVAAHKPSLMAHVVDQIEMAFTETPDRLLALRFAEALEPSGWLGQSLDSIALAAGVSLSRAESMLAVLQGFEPTGLFARDLSDCLILQAREADILTWEVETLIRNIRLIAENRLSDLADLCDCDIGDIPEIIKQIRHLNPKPGLAFDHQPTPVFPPDLIAVRGAEGWTVELNRATSPTITVREDRFADGTADAKARAERRRRGRGPGAGEALERRGDTLLRTAAVLVARQSAFLDKGPAHLVPLTLEDVASELGLHASTISRAVSGRMIQTQTRALPLRAFFSRAVSTQGGGEAVSRDSLDFVQRTVGGEDRQNPLSDDAIVTLAERAGLRIARRTVAKYRSTLGLASSYERRRAAAAR

rpoN

RNA polymerase sigma-54 factor

414 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-54 factor family.

48.247 kDa

MAILRANLSPKNKLNATLKGWLPILQSELEDLEEVLKQNALDNPLIKIENKRIKNFSDRFNTKKSSDHLENCATASKSLFETLESQIIPPLFPTETSQKIAMDIISGLNNEGYFEENIEERAKVLGVESEVYEKVRKRFSYLNPAGIGAKDVKEGFLFQLDGRELDNNELYEETRKIILNLEKHHEFSKDFYYEKALKILKSFKNPPAIEFLEKEIEVIPELFILEVDNEMIVRLNDESYPTISLEENRFKDSDYLKEKLKEAKDLIDALNLRKATIYKIGLMLLEYQYDFFKGKELRPLKLLDLANEFNHSVSTISRAISNKYLACERGVFPIKHFFSIALDNSETSNAVIKDYLLELIKNEDKKEPLSDAKILELIEEKFHLKMVRRTITKYRQLLNIASSSERKRLYLMRA

rpoN

RNA polymerase sigma-54 factor

414 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-54 factor family.

48.173 kDa

MAILRANLSPKNKLNATLKGWLPILQSELEDLEEVLKQNALDNPLIKIENKRIKNFSDRFSAKKSSDHLENFATASKSLFETLEAQIIPPLFPTETSQKIAMDIISGLNNEGYFEENIEERARILGVESEVYEKVRKRFSYLNPAGIGAKDVKESFLFQLESRELDDNELYEETRKIILNLEKHHEFSKDFYYEKALKILKSFKNPPAIEFLEKEIEVIPELFIVEVDNGIIVRLNDESYPTISLEENRFKDSGYLKEKLKEAKDLIDALNLRKATIYKIGLMLLEYQYDFFKGKELRPLKLLDLANEFNHSVSTISRAISNKYLACERGVFPIKHFFSIALDNSETSNAVIKDYLLELIKNEDKKEPLSDAKILELIEEKFHLKMVRRTITKYRQLLNIASSSERKRLYLMRA

rpoN

DNA-directed RNA polymerase subunit N

77 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.843 kDa

MLPPVRCFTCGRPLGHLWPRFRELVASGKTPGEALDELGVDRYCCRRTLFTSVTYIEHAAKYRVGIHVPPERLKMWG

rpoN

DNA-directed RNA polymerase subunit N

76 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.695 kDa

MDVPRNENSSDFPIRCFSCGAVIGHLYDEYKQKLSEGKSPKEALDELGIERYCCRRMFITHKSVIKELSRFHGAVG

rpoN

DNA-directed RNA polymerase subunit N

73 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.695 kDa

MMFPIRCFSCGNVIAEVFEEYKERILKGENPKDVLDDLGIKKYCCRRMFISYRIGEDGREIIDEIIAHDERYL

rpoN

DNA-directed RNA polymerase subunit N

72 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.368 kDa

MIIPVRCFSCGRVIASDYGRYIKRVNEIKAEGRDPSPEEIEKIFDDLGIERYCCRRMIVSHVDLISEIMPFS

rpoN

DNA-directed RNA polymerase subunit N

72 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.483 kDa

MIIPVRCFSCGRVIASDYGRYLRRINEIRSEGREPTAEEIEKIFDDLGVERYCCRRMIISHVDLINEIMPFS

rpoN

DNA-directed RNA polymerase subunit N

72 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.423 kDa

MIIPIRCFTCGRPIAHLWEKYVELIEEEGMEPGEALDELGVDRYCCRRMFLSHVDLLEESLPYTPPRLGMPR

rpoN

DNA-directed RNA polymerase subunit N

72 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.336 kDa

MIIPVRCFSCGRVIASDYVRFTEACTKIINETGREPRGEEKAKILDDLGVKRYCCRRMILSHKDLIDEVLPY

rpoN

DNA-directed RNA polymerase subunit N

71 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.311 kDa

MIPVRCFTCGKVISEVWEEYKARVEERKMNLQHGEVLKVGDILDDLGVERYCCRRMLLSHVELVDVLAPYQ

rpoN

DNA-directed RNA polymerase subunit N

68 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.212 kDa

MIFPIRCFSCGAVISEVYEEYRTRLKNGENPEEILNDLEVKKYCCRRMFASHRLDNDRELFDDIVEYK

rpoN

DNA-directed RNA polymerase subunit N

68 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.226 kDa

MIFPIRCFSCGAVISEVYEEYRNRLKDGENPEEILNDLEVKKYCCRRMFASHRLDNDRELFDDIVEYK

rpoN

DNA-directed RNA polymerase subunit N

68 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.213 kDa

MIFPIRCFSCGAVISEVYEEYRTRLKDGENPEEILNDLEVKKYCCRRMFASHRLDNDRELFDDIVEYK

rpoN

DNA-directed RNA polymerase subunit N

68 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.269 kDa

MIFPIRCFSCGNVISEVYEEYRTRLKNGENPEEILNDLEIKKYCCRRMFASHRLDNDRELFDDIVEYK

rpoN

DNA-directed RNA polymerase subunit N

68 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

8.044 kDa

MIFPIRCFSCGNVISEVYDEYKTRLSNVESPEEILNDLGVTKYCCRRMFASHRLENGKELFDDIVEYR

rpoN

DNA-directed RNA polymerase subunit N

67 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.782 kDa

MIVPIRCWTCGRPLGHLWEPFRNRVLAGEDPGKVLDDLHVTRYCCRRTLLAHVELINQVLPYGLIEK

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.732 kDa

MIVPIRCFTCGKPLGHLYITFKHRVLAGEHPGRVLDELGVHRYCCRRTLIAHVEWIDDLLVYEKRS

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.753 kDa

MIIPVRCFTCGRPLGHLYPIFKRRVLAGERPGEVLDSLGVYRYCCRRTLLSHVEWIDDVLAYERRS

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.591 kDa

MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.695 kDa

MMFPVRCFTCGAPIGHLWEEFKKRVEAGEDPGKVLDDLGVKRYCCRRMFLSHIEISYEILNFPKVS

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.662 kDa

MIIPIRCFTCGAVVADKWEPFSNRVMGGEDPEKVLTELGVNRYCCRRMLLSHVNIIREIIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.606 kDa

MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.606 kDa

MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.606 kDa

MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.606 kDa

MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.606 kDa

MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.606 kDa

MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.619 kDa

MIIPIRCFTCGSLIGDKWEPFITRVSNGEDPGKVLDDLGVKRYCCRRMLLSHVDIIKEVIHYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.731 kDa

MMVPVRCFTCGNVVGEHWEEFKARTREAEEPEDPEKVLDELGVERHCCRRMLVSHKDLVDIVSPYQ

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.443 kDa

MMVPVRCFSCGTVVGEHWEAFKARAETHDGDEDPADVLDDLGVDRHCCRRMLIAHQDLVDVVSPYQ

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.443 kDa

MMVPVRCFSCGTVVGEHWEAFKARAETHDGDEDPADVLDDLGVDRHCCRRMLIAHQDLVDVVSPYQ

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.859 kDa

MIIPMRCFTCGRPLAQYWEEFRSRVEGGEDPRKVLDELGVKRYCCRKTLLAHVPAIYEVRKFKRVL

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.547 kDa

MIIPVRCFTCGSLIADKWDAFSTRVRAGEDPGKVLDDLNVKRLCCRRSLLTHVDIIREVVNYTRPI

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.717 kDa

MIIPIRCFTCGKPLGHLYAVFKRRVLAGEHPGRVLDDLGVTRYCCRRTLMAHVEWIDDVLLYERRS

rpoN

DNA-directed RNA polymerase subunit N

66 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.657 kDa

MIIPVRCFTCGKPLGHLYAVFKKRVLAGEHPGRVLDELGVVRYCCRRTLMAHVEWIDDLLVYERRG

rpoN

DNA-directed RNA polymerase subunit N

65 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.773 kDa

MIIPVRCFTCGKVIGDKYYEFKRRVEAGEDPEKVLDDLGLERYCCRRMLLSHVELIDDIMHYKVY

rpoN

DNA-directed RNA polymerase subunit N

65 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.59 kDa

MIVPVRCFTCGKVLADKYYEFKKRVEAGEDPGKVLDDLGVERYCCRRTLLSHVELIDQVMVYKVY

rpoN

DNA-directed RNA polymerase subunit N

65 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.648 kDa

MIVPVRCFTCGKVIGDKYYEFKARVEKGEDPEKVLDDLGVERYCCRRTLLSHVELIDQVMVYKVY

rpoN

DNA-directed RNA polymerase subunit N

65 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.491 kDa

MLPPIRCFSCGKPLGHLWEEFNERVNKGEDPKKVLDDLGLERYCCRRTLLSAVVVFPVIAKFKKV

rpoN

DNA-directed RNA polymerase subunit N

65 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.787 kDa

MIVPVRCFTCGKVIGDKYYEFKRRVEAGEDPEKVLDDLGLERYCCRRMLLSHVELIDDIMHYRVY

rpoN

DNA-directed RNA polymerase subunit N

65 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.544 kDa

MIIPVRCFTCGKPLGHLYAVFKQRVLAGEHPGKVLDDLGLVRYCCRRTLMAHVEWIDDVLIYEKR

rpoN

DNA-directed RNA polymerase subunit N

65 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.787 kDa

MIVPVRCFTCGKVIGDKYYEFKRRVEAGEDPEKVLDDLGLERYCCRRMLLSHVELIDDIMHYRVY

rpoN

DNA-directed RNA polymerase subunit N

64 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.465 kDa

MMIPVRCFTCGNVVGEHWEEFKERAREGDEDPGKVLDELGVDRHCCRRMMVSHRDLVDVVSPYQ

rpoN

DNA-directed RNA polymerase subunit N

64 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.434 kDa

MMIPVRCFTCGTVIGEHWDEFKQRARDGNEDPGEVLDDLGIKRHCCRRMMVSHRDLVDVVAPYQ

rpoN

DNA-directed RNA polymerase subunit N

64 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.296 kDa

MMVPVRCFTCGTVVGEHWGEFKERAREGDEDPAEVLDELGVERACCRRMLVSHKDLVDIVSPYQ

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.163 kDa

MIPVRCFSCGKVISNYWDEYKRRVTDGEGSAAVLDDLGITRYCCRRMFLSHVELVDVLSPYQ

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.372 kDa

MIPVRCFTCGKVISPAWEEYKARREKGEDPKKILDDLGITRYCCRRMLLTHKEIIDELNPYQ

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.156 kDa

MIPVRCFSCGKVISNYWDEYKRRVSDGENAAAVLDDLGITRYCCRRMLLSHVELVDVLSPYQ

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.203 kDa

MIPVRCFTCGKVIAGSWEEYKRRTGEGEDPATVLDDLKFVRYCCRRMFLAHVELVDTMAPYQ

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.441 kDa

MIPVRCFTCGKVISTAYEEFKRRRDASEDPKRILDDLGMDRYCCRRMLLTHKEIIDELNPYQ

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.286 kDa

MIPVRCFTCGKVISTVWEEYQQRKAAGEDPKEILDSLGLDRYCCRRMLLSHKETVDELYPYT

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.219 kDa

MIPVRCFSCGKVISNYWDEYKRRVTDGEDAAAVLDDLGITRYCCRRMFLSHVELIDVLSPYQ

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.362 kDa

MIPVRCFTCGKVVSTAWKEFKERRDAGEDPKRILDDLGLERYCCRRMLLTHKETVEDLNPYQ

rpoN

DNA-directed RNA polymerase subunit N

62 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.189 kDa

MIPVRCFTCGKVISTAWEEFKQRRDAGEDPGAILDDLGLTQYCCRRMLLTHKEIIDELNPYQ

rpoN

DNA-directed RNA polymerase subunit N

61 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

7.309 kDa

MIPVRCFSCGKVISSVWEEYRERIKSEPPGKVMDDLGIERYCCRRMLLSHVEVVEMLRRYQ

rpoN

DNA-directed RNA polymerase subunit N

55 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

6.434 kDa

MIPVRCLSCGKPVSAYFNEYQRRVADGEDPKDVLDDLGLKRYCCRRMLISHVETW