rplB

50S ribosomal protein L2

304 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

34.593 kDa

MGVRKLKPVTNGTRHAVLYDFEEIEKLVRKGKEWVLLKKNQVEPEKSLLKWWHRAKGRSRQRGNITARHRGGGHKKLYRIIDFKRDKSLVPAKVVSIEYDPFRSARICLLHYADGEKRYIIWPEGLKVGDTVMSISWEDAEAGKPLPEIKPGNAMPLKYIPEGTIVHNIEFIPGKGGQIARAAGTWAQVLGRSTRKGYVLVRMPSGEVRMIHERCMATVGRVGLAEHELVKLGKAGRARWLGWRPHTRGTAMNPVDHPHGGGEGRTRGKHPESPWGWKTKGYKTRRGKKYSDQFIVTRRDGRPL

rplB

50S ribosomal protein L2

295 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

33.313 kDa

MGVRKLKPVTNGTRHAVLYDFEEIEKLVRKGKELVLVKKNKVEPEKSLLKWWHRAKGRSRQRGNITARHRGGGHKKLYRIIDFERDKSLVPAKVVSIEYDPFRSARICLLHYADGEKRYIIWPEGLKVGDTVMSISWEDAEAGKPLPEIKPGNAMPLKYIPEGTIIHNIEFMPGKGGQIARAAGTWAQVLGRSTKKGYVLVRMPSGEVRMIHERCMATIGRVGLAEHELVNVGKAGRARWLGWRPHTRGTAMNPVDHPHGGGEGRTRGKHPESPWDGRRRDTRREGVRSTPISLS

rplB

50S ribosomal protein L2

294 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

32.749 kDa

MGIRTFRPYTPSTRHMTVSNFEELSRDENGKRPRPEKSLLQFIHRKKGRNNRGVITCRHRGGGHKRLYRIIDFRRDKRGIPATVKTIEYDPNRSARICLVEYEDGEKRYILAPRNLEVGATIMAGPDAPFELGNAMPLERIPLGTVVHNVELYPGRGGQIVRAAGAGAQVVAKEGKYVSLKLPSGEVRMIRGECYATIGQVGNVDHSNLSLGKAGRSRWLGRRPHVRGSVMNPVDHPHGGGEGKAPIGRSTPVTPWGKPTLGYKTRKRNKPSNKFIVRGRRRGGRRDKSGRAAQ

rplB

50S ribosomal protein L2

294 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

32.774 kDa

MGIRTLRPYTPSTRHMTVSDFEELSRDENGKRPRPEKSLLQFIHRKKGRNNRGVITCRHRGGGHKRLYRIIDFRRDKRGIPGTVKTVEYDPNRSAHICLVEYEDGEKRYILAPRNLQVGSTIMAGPEAPFEIGNAMPLERIPLGTVVHNVELYPGRGGQMVRAAGAGAQVVAREGKYVSLKLPSGEVRMIRGECYATIGQLGNVDHNNISLGKAGRSRWLGRRPKVRGSVMNPVDHPHGGGEGRAPIGRSTPVTPWGKPTLGYKTRKRNKPSNKFIVRGRRRGGRRDKGGRAAQ

rplB

50S ribosomal protein L2

288 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.298 kDa

MAIHSFRPLTPAGRFTSLNKREGLSKKRPQKALTEPKPKTGGRNVYGRITTRHIGGGHKQLYRIIDFKRDILDMPATVEALEYDPNRTSNLALVVYANGEKKYILAPEGLQVGAKIFASNKATTNDYNVGNNFPLHLIPPSTRVHAVELVPGRGAKIARAAGTGLELVAVEGDRATLKMPSGELRLVNAKCRATIGEVGNGDHNNQSLGKAGRRRWLGVRPTVRGMVMNPVDHPNGGGQGKSKGGGGRQQLVSPWGQLAKGFPTRRRSKQSNAQIIVHHNGRKPRGKK

rplB

50S ribosomal protein L2

288 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.857 kDa

MGIRVYRPYTPGVRQKTVSDFAEITTDKPEKSLTRGFKRDKGRNNRGVITSRRRGGGHKRRYRIVDFRRSSKLNIPAKVATVEYDPNRNARIALLHYRDGEKRYILHPRDLTPGTEIIASPDAPIEVGNALPLGKIPLGTSVHNVEITPGRGAQMVRAAGAMAQVVAKEGDMVTLKLPSGEVRLFRKECYATIGQVGNVEANNISLGKAGRNRWKGRRPKVRGSVMNPVDHPHGGGEGRAPIGRPGPVTPWGKPTLGYKTRKKKKLSDALIVRRRKKSSKRGRGGRQS

rplB

50S ribosomal protein L2

288 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

32.422 kDa

MGVRKLKPVTNGQRHAILYDYSELTRREPEKSLTYYYKRALGRSRQQGKITSRWKGAGNKIRYRLIDFKRDKSLIPAKVYSIEYDPFRSARIVLLHYKDGEKKYILWPDKLNVGDTVVSISYEDAIKGKELPDIKPGNAMPLRFIPVGTFIHNIELNPGRGAKLVRAAGLSAQVIGKIEGYAQVRLPSGEVRLINDKCMATIGVVGLAEHELVKLGKAGRSRWLGMRPNVRGTAMNPVDHPHGGGEGKTKGKHPESPWGWKTKGYKTKRGKRYSDRFIISKRNAGGKV

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.589 kDa

MGTRSYRPYTPSTRQVTVSDFAEITKTEPEKSLTTSKHRAKGRNNTGRITSRRRGGGHKQLYRIIDFKRDKHNIPAKVAAIEYDPNRNARIALLYYQDGEKRYILHPNGLKVGTIIISGPESPFEDGNALPLSRIPLGTSVHNVEMTPGKGGQIVRAAGASAQVVAKEGDYVTLKLPSGEVRLIRRDCYATIGQVGNTDARNLSAGKAGRNRWKGRRPKVRGSVMNPVDHPHGGGEGRAPIGRSGPVTPWGKPTLGAKTRNRKKLSSKFIVRRRRKSSKRGRGGRES

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.504 kDa

MGTRSYRPYTPSTRQVTISDFAEITKTEPEKSLTVYKHRAKGRNNQGRITSRRRGGGHKRLYRIIDFKRDKRSIPATVIAIEYDPNRNARIALVSYEDGEKRYILHPNNLKVGTVIIAGPESPIEDGNALPLANIPLGTSVHNVELKAGKGGQIVRSAGATAQVVAKEGNYVTLKLPSGEVRLIRRECYATIGQVGNTDARNLSAGKAGRNRWKGRRPKVRGSVMNPVDHPHGGGEGRAPIGRSGPVTPWGKPTLGAKTRKPKKASSKLIIRRRRKSSKRGRGGRES

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.739 kDa

MGIRSYRPYTPSTREHSVSDFAEVTKSRPEKTLVKFRHRKKGRNNRGVVTCRHRGGGTKKLYRVVDFHRNKHNIPAKVAAIEYDPYRNARIALLHYQDGEKRYILHPLGLKVGQLITSGVNAPLEIGNALPLSKIPLGTDVHNVELVPGKGGQMVRSAGAVAQVVAKEDQYVTIKLPSGERRKVRASCYATLGQIGNIEHRNISLGKAGRNRWKGKRPTVRGSVMNPVDHPHGGGEGRAPVGRSGPVTPWGKPALGMKTRKKKKQSDALIVQRRRKSSKRGKGGRQS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.504 kDa

MGTRSYRPYTPSTRQVTISDFAEITKTEPEKSLTVYKHRAKGRNNQGRITSRRRGGGHKRLYRIIDFKRDKRSIPATVIAIEYDPNRNARIALVSYEDGEKRYILHPNNLKVGTVIIAGPESPIEDGNALPLANIPLGTSVHNVELKAGKGGQIVRSAGATAQVVAKEGNYVTLKLPSGEVRLIRRECYATIGQVGNTDARNLSAGKAGRNRWKGRRPKVRGSVMNPVDHPHGGGEGRAPIGRSGPVTPWGKPTLGAKTRKPKKASSKLIIRRRRKSSKRGRGGRES

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.603 kDa

MGIRNYRPYTPGTRQKSVSDFSEITHDQPEKSLTSFRHRAKGRNNRGVITSRRRGGGHKRLYREIDFRRNKLSVPGTVLTVEYDPNRNARISLVQYEDGEKRYILHPRNLAVGAVIAAGPDAAIEVGNALPLSKIPLGTGVHNVEITPGRGGQMVRAAGAMAQVVAKEGDMVTLKLPSGEVRLFRKECYATIGQIGNVDVNNISIGKAGRNRWKGRRPKVRGSVMNPVDHPHGGGEGRAPIGRSGPVTPWGKPTLGYKTRKKKKLSNALIVRRRRKSSKRGRGGRQS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.653 kDa

MGIRAFRPYTPGTRERVVSDYAEITRNEPEKSLLVSKHRRKGRNNRGVITCRHRGGGHKRLYRIIDFKRDKRNVPGKIVSIEYDPNRNARISLVYYEDGEKRYILTPAGVHVGTPIIAGDETPIEVGNAMPLQNIPLGTTVHNVELVAGKGGQIVRAAGASAQVVAKEGNYVALKLPSTEVRLVRKECYATIGAVGNAEVRNTSLGKAGRKRWLGRRPEVRGSVMNPVDHPHGGGEGRAPIGRSGPVTPWGKPALGRKTRKKNKQSDCLIQRRRRKSSKRGRGGRDA

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.625 kDa

MAIRSFRPYTPGTRTRVVTDFSEVTGRKPERSLVVSKHRRKGRNNRGVITCRHRGGGHKRQYRVVDFRRNKHGVPAKVAAIHYDPHRNARLALLFYTDGEKRYILAPAGVTVGQTVISGPDAPIEDGNAMPLSSVPLGSSVHCVELYAGRGGQMVRTAGASAQVMAKEGDYVALKLPSTEVRLVRRECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNKFVLRKRRKTSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.651 kDa

MAIRNFRPYTPGTRTRVVTDFSEVTGRKPERSLVVSKHRRKGRNNRGVITCRHRGGGHKRLYRVVDFRRNKHGITAKVAAIHYDPHRNARLALLFYADGEKRYILAPAGVQVGQTVVSGPDAPIENGNAMPLSAVPLGSSVHCVELYAGRGGQMVRTAGASAQVMAKEGDYVALKLPSTEVRLVRRECYATLGEVGNSEVRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNRYVLRKRRKTSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.74 kDa

MGIRSFRPYTPGTRTRVVSDFSEVTRRKPERSLVVAKHRRKGRNNRGVITCRHRGGGHKRLYRIVDFRRDKHGVVARVAAIQYDPHRNARLALLYYTDGEKRYILHPAGVQVGQEVVAGPEAPIEVGNALPLSAIPLGSAVHNVELYAGRGGQMVRTAGASAQVMAKEGDYVALKLPSTEVRLVRRECYATLGEVGNSEVRNTSLGKAGRKRWLGRRPEVRGSVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNKFVLRKRRKTSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.637 kDa

MAIRTFRPYTPGTRTRVVTDFSEVTGRKPERSLVVSKHRRKGRNNRGVITCRHRGGGHKRQYRLVDFRRNKHGVTAKVAAIHYDPHRNARLALLFYADGEKRYILAPAGISIGQTVVSGTEVPIEIGNAMPLSAIPLGSSVHCVELYAGRGGQMVRTAGASAQVMAKEGDYVALKLPSTEVRLVRRECFATLGEVGNAEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNKFVLRKRRKTSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.669 kDa

MAIRKFRPYTPGTRTRVVTDFSEVTGRKPEKTLVVSKHRKKGRNNRGVITCRHRGGGHKRLYRLVDFRRNKHGVTAKVAAIHYDPHRNARLALLFYSDGEKRYILAPAGVQVGQTVVSGPEVPIENGNAMPLSSVPLGSSVHCVELYAGRGGQMVRTAGASAQVMAKEGDYVALKLPSTEVRLVRRECYATLGEVGNSEVRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNQYVLRKRRKTSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.679 kDa

MAIRNFRPYTPGTRTRVVTDFSEITSRKPERTLVVAKHRRKGRNNRGVITCRHRGGGHKRLYRVVDFRRNKHGVPAKVAAIHYDPHRNARLALLFYADGEKRYILAPAGVQVGQTVVSGPDAPIENGNAMPLSSVPLGSAVHCVELYAGRGGQMVRTAGASAQVMAKEGDYVALKLPSTEVRLVRRECYATLGEVGNSEMRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNQYVLRKRRKTSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.862 kDa

MGIRYYRPYTAGTRQKTSSDFAEITRDRPEKSLVKAKHRAKGRNNRGVITSRRRGGGHKRRYRIIDFYRNKLGVPGTIATVEYDPNRNARIALVNYKDGEKRYILHPRNVQVGTTIVAGPDAPIEVGNALPLERIPLGTEVHNVELIPGKGGQLARAAGALAQVVAKEGKMVTLKLPSGEVRLFQKECYATIGQVGNVESNNITIGKAGRNRWKARRPKVRGSVMNPVDHPHGGGEGRAPIGRSGPVTPWGKPTLGYKTRKKKKQSNKLIVRRRRRSSKRSRGGRQS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.784 kDa

MAIRKFKPYTPGTRQRVVTDFSEITSSKPERSLIVSKHRVKGRNNRGVITCRHRGGGHKRQYRLVDFRRDKRNINAKVAAIHYDPHRNARLALLFYEDGEKRYIIAPAGVKVGQNVISGESVPIEDGNAMPLSVMPLGSSVHCVELYAGRGAQMVRSAGASAQVMAKEGDYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPIGRAGPVTPWGKPALGLKTRKKNKPSNKLVVRRRRRISKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.491 kDa

MAIRSFKPYTPGTRSRVVTDFSEVTSSKPERSLVVSKHRKKGRNNRGVITCRHRGGGHKRLYRIVDFRRNKHGVSAKVAAIHYDPHRNARLALLFYSDGEKRYILAPADITVGQEVISGPDAPIETGNALPLSSMPLGSSVHCVELYPGRGGQMVRTAGASAQVMAKEGDYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPVGRAGPVTPWGKAALGLKTRKKNKPSNKYVLRKRRKVSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.778 kDa

MAIRKFKPYTPGTRQRVVTDFSEITSAKPERSLIVPKHRVKGRNNRGVITCRHRGGGHKRQYRLVDFRRDKRNINAKVAAIHYDPHRNARLALLFYEDGEKRYIIAPAGVKVGQNVISGESVPIEDGNAMPLSVMPLGSSVHCVELYAGRGAQMVRSAGASAQVMAKEGDYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPIGRAGPVTPWGKPALGLKTRKKNKPSNKLVVRRRRRISKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.744 kDa

MAIRTFRPYTPGTRTRVVTDFNEVTGRKPERSLVVAKHRRKGRNNRGVITCRHRGGGHKRLYRIVDFRRNKHGIPAKVAAIHYDPHRNAHLALLFYTDGEKRYILAPNGIAIGQQLISGPESPIETGNALPLSAIPLGSSVHNVELYAGRGGQMARTAGSSAQVMAKEGDYVALKLPSTEVRLVRHECYATLGEVGNSEVRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNRFVLRKRRRTSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.784 kDa

MAIRTFRPYTPGTRTRVVTDFNELTGRKPERSLVVSKHRLKGRNNRGVITCRHRGGGHKRLYRIVDFRRNKHDVPAKVAAIHYDPHRNARLALLFYSDGEKRYILAPAGIAIGQEVISGPKVPIETGNAMPLSAIPLGSSVHCVELYAGRGGQMVRSAGASAQVMAKEGDYVALRLPSTEVRLIRRECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPVGRAGPVTPWGKPALGLKTRKRNKPSNRFVLRKRRRVSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.671 kDa

MAIRKFKPYTPGTRQRVVTDFSEITGSKPERSLIVSKHRNKGRNNRGVITCRHRGGGHKRQYRLVDFRRDKRNINAKVAAIHYDPHRNARLALLFYEDGEKRYIIAPAGIKVGQNVISGDSVPIEDGNAMPLSVMPLGSSVHCVELYAGRGAQMVRSAGASAQLMAKEGDYVALKLPSTEVRLVRKECYATLGEVGNAEIRNTSLGKAGRTRWLGRRPQVRGSVMNPCDHPHGGGEGKAPIGRAGPVTPWGKAALGLKTRKKNKPSNNLVVRRRRRISKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.768 kDa

MAIRKFKPYTPGTRQRVVTDFSEITSAKPERSLIVSKHRVKGRNNRGVITCRHRGGGHKRQYRLVDFRRDKRNINAKVAAIHYDPHRNARLALLFYEDGEKRYIIAPAGVKVGQNVISGESVPIEDGNAMPLSVMPLGSSVHCVELYAGRGAQMVRSAGASAQVMAKEGDYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPIGRAGPVTPWGKPALGLKTRKKNKPSNKLVVRRRRRISKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.755 kDa

MAIRTFRPYTPGTRTRVVTDFNEVTGRKPERSLVIAKHRLKGRNNRGVITCRHRGGGHKRQYRLVDFRRNKHGVPAKVAAIHYDPHRNARLALLFYKDGEKRYILAPAGISIGQEVLSGKDVPIEIGNALPLSSIPLGSSVHCVELYPGRGGQMVRCAGSSAQLMAKEGEYVALKLPSTEVRLVRGECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPVGRAGPVTPWGKPALGLKTRKRNKPSNRFVLRKRRRVSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.715 kDa

MAIRTFRPYTPGTRTRVVTDFNEVTGRKPERSLVVAKHRRKGRNNRGVITCRHRGGGHKRLYRIVDFRRNKHGIPAKVAAIHYDPHRKAHLALLFYTDGEKRYILAPAGIAIGQQLISGPESPIETGNALPLSAIPLGSSVHNVELYAGRGGQMARTAGSSAQVMAKEGDYVALKLPSTEVRLVRHECYATLGEVGNSEVRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNRFVLRKRRRTSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.756 kDa

MAIRKFKPYTPGTRQRVVTDFSEITGSKPERSLIVSKHRNKGRNNRGVITCRHRGGGHKRQYRLVDFRRDKKNINAKVAAIHYDPHRNARLALLFYEDGEKRYIIAPAGIKVGQNVISGEGVPIEEGNAMPLSSMPLGSNVHCVELYAGRGAQMVRSAGASAQLMAKEGEYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPIGRAGPVTPWGKAALGLKTRKKNKPSNKLVVRRRRRISKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.754 kDa

MAIRKFKPYTPGTRQRVVTDFSEITSAKPERSLIVSKHRVKGRNNRGVITCRHRGGGHKRQYRLVDFRRDKRNINAKVAAIHYDPHRNARLALLFYEDGEKRYIIAPAGVKVGQNVISGESVPIEDGNAMPLSVMPLGSSVHCVELYAGRGAQMVRSAGASAQVMAKEGDYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPIGRAGPVTPWGKPALGLKTRKKNKPSNKLVVRRRRRVSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.491 kDa

MAIRSFKPYTPGTRSRVVTDFSEVTSSKPERSLVVSKHRKKGRNNRGVITCRHRGGGHKRLYRIVDFRRNKHGVSAKVAAIHYDPHRNARLALLFYSDGEKRYILAPADITVGQEVISGPDAPIETGNALPLSSMPLGSSVHCVELYPGRGGQMVRTAGASAQVMAKEGDYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPVGRAGPVTPWGKAALGLKTRKKNKPSNKYVLRKRRKVSKRSRGGRDS

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.706 kDa

MGIRAFRPYTPGTRERVVSDYAEITRNEPEKSLLVSKHRRKGRNNRGVITCRHRGGGHKRLYRIIDFKRDKRNVPGKIVSIEYDPNRNARISLVYYEDGEKRYILTPAGVHVGTPIIAGDETPIEVGNAMPLQNIPLGTTVHNVELVAGKGGQIVRAAGASAQVVAKEGNYVALKLPSTEVRLVRKECYATIGAVGNAEVRNTSLGKAGRKRWLGRRPEVRGSVMNPVDHPHGGGEGRAPIGRSGPVTPWGKPALGRKTRKKNKQSDRLIQRRRRKSSKRGRGGRDA

rplB

50S ribosomal protein L2

287 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.902 kDa

MPIKKIISRSNSGIHHSTVIDYKKLLTTNKNKPEKSLLVTLKKHGGRNNQGKITVRHQGGRNKRKYRIIDFKRTHYDNIEATVKSIEYDPNRSCFVSLITYANGAKSYIISPDGIKVGDKILASEHPIDIKPGFSMPLAFIPEGTQVHNIELHPKGGGQIARSAGSYARILGQDETGKYVILQLLSGETRKFLKECRATVGVVSNLDHNLVVIGKAGRNRHRGIRPTVRGSAMNPNDHPHGGGEGRSPVGRDAPRTPWGKRHMGVKTRNMKKASTNLIIRNRKGEQY

rplB

50S ribosomal protein L2

286 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.109 kDa

MGIRIYKPTSAGRRNASVSDFKELTPGYTPERSLLRPKTKTGGRNNQGKITSRHRGGGHKQKYRVIDFRRVKDGVVATVDSVQYDPNRTARIALLKYPDGEKHYVIAPSGVAAGDKLQNGPDAPPVVGNCLPLKNIPLGTSVCCIEMRAGRGAVMCRSAGTQATLQAREADWAQLLLPSGEVRRVPSACRATIGQVGNSDHMNIVLGKAGRSRWLGRRPHVRGTAMNPIDHPHGGGEGRTKGGRHPVSPSGKSAKGGRTRQKRKPSNSSIVRRRKSRRYGQLKLHK

rplB

50S ribosomal protein L2

285 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.883 kDa

MAIKKIISRSNSGIHNATVIDFKKLLTNSKPEKSLLVTLKKHAGRNNQGKITVRHHGGRHKRKYRLIDFKRYHYDNLKATVKSIEYDPNRSCFISLLHYQNGVKTYIISPDGIKVGDQVYSSDHAIDIKLGYCMPLAFIPEGTQVHNIELNPKGGGKIARSAGSYARILGQDETGKYIILQLISGETRKFLKECRATVGVVSNLDHNLVVIGKAGRSRHKGIRPTVRGSAMNPNDHPHGGGEGRSPVGRDAPRTPWGKRHMGVKTRNMKKHSTNLIIRNRKGEQY

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.409 kDa

MFKKFKPVTPGTRQLVLPAFDELTTQGELSGKKTRKSVRPNKKLSFFKKSSGGRDNLGHISCRHRGGGAKRLYRVIDFKRNKDGIEAKVVSVEYDPNRSAYIALLSYADGEKRYILAPKGIKRGDQVISGEGSPFKLGCCMTLKSMPLGSTVHNIEMRPHSGGKLVRSAGLAAQVIAKTPGYVTLKMPSGEFRMLNEGCRATIGEVSNSDHNLCVDGKAGRKRWKGIRPTVRGTAMNPVDHPHGGGEGRHNGYIPRTPWGKVTKGLKTRDKRKSNKWIVKDRRK

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.421 kDa

MFKKFKPVTPGTRQLVLPAFDELTRQGELSGKKTRKSVRPNKKLSFFKKSSGGRDNLGHISCRHRGGGVKRLYRVIDFKRNKDGIEAKVVSVEYDPNRSAYIALLNYADGEKRYILAPKGIKRGDEVISGEGSPLKLGCCMTLKSMPLGSTVHNIEMRPNSGGKLVRSAGLAAQVIAKTPGYVTLKMPSGEFRMLNEGCKATIGEVSNSDHNLCVDGKAGRKRWKGVRPTVRGTAMNPVDHPHGGGEGRHNGYIPRTPWGKVTKGLKTRDKRKSNKWIVKDRRK

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.49 kDa

MFKKFKPVTPGTRQLVLPAFDELTRQGDLTGKRTRKSVRPNKKLSFFKKSSGGRDNLGHISCRHRGGGAKRLYRVIDFKRNKDGIEAKVVSVEYDPNRSAYIALLNYADGEKRYILAPKGIKRGDQVISGEGSPFKLGCCMTLKSMPLGSTVHNIEMRPHSGGKLVRSAGLAAQVIAKTPGYVTLKMPSGEFRMLNEGCRATIGEVSNADHNLCVDGKAGRKRWKGVRPTVRGTAMNPVDHPHGGGEGRHNGYIPRTPWGKVTKGLKTRDKRKSNKWIVKDRRK

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.476 kDa

MFKKFKPVTPGTRQLILPSFDELTTQGELEGSSSKRSVRPNKKLSFFKKSSGGRDNLGHISCRHRGGGVRRHYRVIDFKRNKDGVEAKVASVEYDPNRSAYIALLNYVDGEKRYILAPKGIKRGDRVISGEGSPFKTGCCMTLKSIPLGISVHNVEMRPGSGGKLVRSAGLSAQIIAKTDGYVTLKMPSGEFRMLNEMCRATVGEVSNADHNLCVDGKAGRRRWKGIRPTVRGTAMNPVDHPHGGGEGRHNGYISQTPWGKVTKGLKTRDKRKSNKWIVKDRRK

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.364 kDa

MFKKFKPVTPGTRQLVLPAFDELTTRGELRGTKSKRSLRPNKKLSFFKKSSGGRDNLGHISCRHRGGGAKQLYRVVDFKRNKDGITAKVVTVEYDPNRSAYIALLSYEDGEKRYILAPKGIQRGDVVVSGEGSPFKPGCCMTLKSIPLGLSVHNIEMRPSSGGKLVRSAGLAAQVIAKSPGYVTLKMPSGEFRMLNEGCRATIGEVSNADHNLRVDGKAGRRRWMGVRPTVRGTAMNPVDHPHGGGEGRHNGYIPRTPWGKVTKGLKTRDKNKSNKWIVKDRRK

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.473 kDa

MFKKFKPVTPGTRQLILPSFDELTTQGELKGSSSRRSVRPNKKLSFFKKSSGGRDNLGHISCRHRGGGVRRHYRVIDFKRNKDGIEAKVASVEYDPNRSAYIALLNYVDGEKRYILAPKGIKRGDRVISGEGSPFKTGCCMTLKSIPLGLSVHNVEMRPGSGGKLVRSAGLSAQIIAKTAGYVTLKMPSGEFRMLNEMCRATVGEVSNADHNLCVDGKAGRRRWKGIRPTVRGTAMNPVDHPHGGGEGRHNGYISQTPWGKVTKGLKTRDKRKSNKWIVKDRRK

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.473 kDa

MFKKFKPVTPGTRQLILPSFDELTTQGELKGSSSRRSVRPNKKLSFFKKSSGGRDNLGHISCRHRGGGVRRHYRVIDFKRNKDGIEAKVASVEYDPNRSAYIALLNYVDGEKRYILAPKGIKRGDRVISGEGSPFKTGCCMTLKSIPLGLSVHNVEMRPGSGGKLVRSAGLSAQIIAKTAGYVTLKMPSGEFRMLNEMCRATVGEVSNADHNLCVDGKAGRRRWKGIRPTVRGTAMNPVDHPHGGGEGRHNGYISQTPWGKVTKGLKTRDKRKSNKWIVKDRRK

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.473 kDa

MFKKFKPVTPGTRQLILPSFDELTTQGELKGSSSRRSVRPNKKLSFFKKSSGGRDNLGHISCRHRGGGVRRHYRVIDFKRNKDGIEAKVASVEYDPNRSAYIALLNYVDGEKRYILAPKGIKRGDRVISGEGSPFKTGCCMTLKSIPLGLSVHNVEMRPGSGGKLVRSAGLSAQIIAKTAGYVTLKMPSGEFRMLNEMCRATVGEVSNADHNLCVDGKAGRRRWKGIRPTVRGTAMNPVDHPHGGGEGRHNGYISQTPWGKVTKGLKTRDKRKSNKWIVKDRRK

rplB

50S ribosomal protein L2

284 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.473 kDa

MFKKFKPVTPGTRQLILPSFDELTTQGELKGSSSRRSVRPNKKLSFFKKSSGGRDNLGHISCRHRGGGVRRHYRVIDFKRNKDGIEAKVASVEYDPNRSAYIALLNYVDGEKRYILAPKGIKRGDRVISGEGSPFKTGCCMTLKSIPLGLSVHNVEMRPGSGGKLVRSAGLSAQIIAKTAGYVTLKMPSGEFRMLNEMCRATVGEVSNADHNLCVDGKAGRRRWKGIRPTVRGTAMNPVDHPHGGGEGRHNGYISQTPWGKVTKGLKTRDKRKSNKWIVKDRRK

rplB

50S ribosomal protein L2

283 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.331 kDa

MSIKKRKPTINSQRQYSVDDKEDITTTDPERSLLEPLPNSGGRNNQGRMTMRYRGGGHKRRYRKIDFKRRDKDGIPATVKTIEYDPNRSARISLLAYADGEKRYIITPDGLEVGDTVMNGPQAQAEVGNCLPLTSIPLGTKVHCVEMTPEKGAQMVRAAGTHAQLTAREGDYATLELPSGETRLVPSKCRATVGTTSNVEHENVVLGKAGRKRWLGRRPRTRGVAMNPIDHPMGGGEGLKSGGHPRSREGVPAKGYKTRKRNKESNKYIIRRRTESKQGTGGQ

rplB

50S ribosomal protein L2

283 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.683 kDa

MGIKDFRPLTPVQRFTSLDDFSDITKTEPEWDLTEPYKKKGGRNNYGRITARHRGGGHKQRYRIIDFKRDKTGIFATVEAIEYDPLRTARIALLRYDDQEKRYIIAPQELKVGSRVVSGPDAPPEVGNSLPLKNIPSGLPIYNIELVPGKGGQLVRSAGSSARMMGLDKEYAIVKLPSGEIRKVCAECYATVGQVSNPDHFNKSLGKAGRTRWLGWRPRVRGVAMNPVDHPNGGGQGKSKGGGGWQQLESPWGKPAKGKKTRHKRKNSTKFIIERRPKKKKKK

rplB

50S ribosomal protein L2

283 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.246 kDa

MPVKKIVNRSNSGIHHKISIDYSKVLTTNTPQKSLLAKKKKNSGRNNQGKITVRHRGGGSKRKYRIIDFKRNLHDDKIALVKSIEYDPNRSAFISLIAYENGYRSYILTPQGIKVGDKVVSSSQAIDIKVGNCMPLEFIPEGTMVHNIEMTPGKGAQIARSAGAYAQILGKDDTGKYINLKLGSKEVRKFLKNCRAVVGIASNVDHNLVLLGKAGTTRHKGIRPTVRGSAMNPNDHPHGGGEGRSPVGRDAPRTPWGKRHMGVKTRNNKKSSTQLIIRRRNSK

rplB

50S ribosomal protein L2

283 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.317 kDa

MAIKYFKPTTNGRRNMSSLDYSKNLTGHEPTKSLMTILKKKAGRNNSGQITTRHKGSGEKRKYRLVDFKRQKDNIEAIVKTIEYDPNRSANISLIVYKDGFKSYILYPKGLKVNDVIVSGEDVDIKIGNTLPLKNIPEGTFIHNIEMQPKGGAIIARSAGSSAQILGKDDNGKYVVLRLKSGETRRILAECRATIGVVGNEEHSLVNVGKAGRNRHKGIRPTVRGSAMNPNDHPHGGGEGKQPIGRKSPMTPWGRKALGPKTRKTNKSSTKLIIRGRKKRINN

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.688 kDa

MGIKKFKPTTNARRGMTQLDYSEITKKSPEKSLLESQSHTAGRNNYGRMTVRHRGGGNKRQYRIIDFKRIKDDVPATVKAIEYDPNRTANIALLVYADGVKSYIIAPKGLKVGDKVQSGSEADIKVGNALPLKDIPVGTVIHNIELKPGKGGQLVRSAGASAQLLGKEGKYVLIRLASSEVRMVLATNRATIGAVGNEEHELVNVGKAGRTRYAGQRPHVRGSVMNPNDHPHGGGEGKAPIGRPSPLSPWGKKTIGKKTRNKHNKSNKFIVRGRKRGRLGNI

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.735 kDa

MALKEYKPTSPARRHMTVADFAEITKAKPEKRLTKPVRKSGGRNAHGKVTTRHIGGGHKRRYRLIDWRRDKDGVPAKVAAIEYDPNRTARIALLHYLDGEKRYILAPVGVAVGDTLLSGADVDIRPGNALPVRTIPLGTVIHNVETAPGSGAKMIRTAGSFGQLMAKEGGYAQIRLPSGEVRKVLQDCKATIGQLGNVESSSVRVGKAGKSRWLGIRPTVRGLAMNPVDHPHGGGEGKSGQGNPHPVSPWGQKTKGLKTRNNRRTDKFIVTRRRPGVRNTQR

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.707 kDa

MALKEYKPTSPARRHMTVADFAEITKAKPEKRLTKPVRKSGGRNAHGKVTTRHIGGGHKRRYRVIDWRRDKDGVPAKVAAIEYDPNRTARIALLHYLDGEKRYILAPVGVAVGDTLVSGADVDIRPGNALPVRTIPLGTVIHNVETAPGSGAKMIRTAGSFGQLMAKEGGYAQIRLPSGEVRKVLQDCKATIGQLGNVESSSVRVGKAGKSRWLGIRPTVRGLAMNPVDHPHGGGEGKSGQGNPHPVSPWGQKTKGLKTRNNRRTDKFIVTRRRPGVRNTQR

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.721 kDa

MALKQYKPTSPARRGMTVSDFAEITKSKPEKKLTKPVRKSGGRNAHGHITTRHIGGGHKRRYRVIDWRRDKDGVPAKVAAIEYDPNRTARIALLNYADGEKRYILAPVGVNVGDTLVSGETVDIRPGNALPIKAIPLGTVIHNVEAQPGSGGKMIRSAGSFGQLMAKEGLYAQIRMPSGEVRKVLQDCKATIGQLSNVENSTVRLGKAGKSRYLGRRPTVRGLAMNPVDHPHGGGEGKSGQGNPHPVSPWGQKTKGQKTRNNRRTDKFIVSRRKPGPRNTPQ

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.735 kDa

MALKEYKPTSPARRHMTVADFAEITKAKPEKRLTKPVRKSGGRNAHGKVTTRHIGGGHKRRYRLIDWRRDKDGVPAKVAAIEYDPNRTARIALLHYLDGEKRYILAPVGVAVGDTLLSGADVDIRPGNALPVRTIPLGTVIHNVETAPGSGAKMIRTAGSFGQLMAKEGGYAQIRLPSGEVRKVLQDCKATIGQLGNVESSSVRVGKAGKSRWLGIRPTVRGLAMNPVDHPHGGGEGKSGQGNPHPVSPWGQKTKGLKTRNNRRTDKFIVTRRRPGVRNTQR

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.635 kDa

MAIKKYKPTSNGRRNMTSLVYKDVITKTTPEKSLLDSQSHSAGRNNAGKMTVRHRGGGNKRQYRIIDFKRIKDDVPATVKAIEYDPNRTANIALLVYADGVKSYIIAPKGLKVGDKVQSGPEADIKTGNALPLKNIPFGTVIHNIELKPGKGGQLVRSAGTSAQLLGKANDEKYVLVRLSSGEVRMVLSVNRATIGAVGNEEHELVNVGKAGRTRWAGQRPHVRGSVMNPNDHPHGGGEGKAPVGLPSPLSPWGKKTVGKKTRSKKNKTEKFIVRHRKGSKM

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.05 kDa

MAVRKLKPTSAGRRFQTVSDFEEITRTRPEKSLTVGLTKKSGRNNLGRITSRRRGGGVKRLYRIIDFKRDKTGIEARVAHIEYDPNRTARIALLHYTDGEKRYILAPVGLKQGDVVMSGVNDRNGEVADIMPGNALPMQRIPVGTVIHNIELYPGKGGQLCRAAGTYAQLVAKEGKYALLRLPSGEVRKVLVTCVATVGQVGNVHHESIRLGKAGRNRWLGRRPKVRGVAMNPIDHPLGGGEGRSSGGRHPVSPWGMPAKGYKTRDKKKASSRLIVKRRGQK

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.196 kDa

MALKYYKPTTNGRRHMSSLDFGANLTTNKPEKSLLTILKKHSGRNSQGKITVRHQGGRHKRKYRLIDFKRNKDDIPGIVKTIEYDPNRSANIALISYIDGEKRYILAPKNLKVGQKISSGPKSDILVGNALPLAKIPEGTFVHNIELKPGAGAKLIRSAGTWAQIQGRDEDGKYVILKLKSGEYRRILATCRATIGVVGNEENSLVNIGKAGRNRHKGIRPTVRGSVMNPNDHPHGGGEGKQPIGRKSPLTPWGKKALGVKTRNPKKPSTKLIIRSRKETKK

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.196 kDa

MALKYYKPTTNGRRHMSSLDFGANLTTNKPEKSLLTILKKHSGRNSQGKITVRHQGGRHKRKYRLIDFKRNKDDIPGIVKTIEYDPNRSANIALISYIDGEKRYILAPKNLKVGQKISSGPKSDILVGNALPLAKIPEGTFVHNIELKPGAGAKLIRSAGTWAQIQGRDEDGKYVILKLKSGEYRRILATCRATIGVVGNEENSLVNIGKAGRNRHKGIRPTVRGSVMNPNDHPHGGGEGKQPIGRKSPLTPWGKKALGVKTRNPKKPSTKLIIRSRKETKK

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.199 kDa

MALKYYKPTTNGRRHMSSLDFGANLTTNKPEKSLLTILKKHSGRNSQGKITVRHQGGRHKRKYRLIDFKRNKDDITGIVKTIEYDPNRSANIALISYIDGEKRYILAPKNLKVGQKISSGPKSDILVGNALPLAKIPEGTFVHNIELKPGAGAKLIRSAGTWAQIQGRDENGKYVILKLKSGEYRRILATCRATIGVVGNEENSLVNIGKAGRNRHKGIRPTVRGSVMNPNDHPHGGGEGKQPIGRKSPLTPWGKKALGVKTRNPKKPSTKLIIRSRKETKK

rplB

50S ribosomal protein L2

282 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.186 kDa

MAIKKYKSTTNGRRNMTTIDYSAVLTTKNNPEKSLVVSKNSKAGRNNRGLITTRHKGGGHKQKYRIIDFKRNKRDIFGTISTIEYDPNRNAFICLINYVDGEKRYILFAKGMQVGMKVVASENADIKVGNVAPLKNIPEGTLLHNVELKPGKGGQIARSAGSSVQLLGKDDDGKYVTLRLSSGEVRKVLAECYATIGEVGNEEYNLVNWGKAGRNRWRGIRPTVRGSVMNPNDHPHGGGEGRAPIGRKSPVTPWGKKALGVKTRNTKKTSEKLIVRKRSNKK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.349 kDa

MFKKYRPVTPGTRQLALPTNEQLTRPCENSRATVKPTKSLLLPKRRTNGRNNNGHITCRHKGGGHKQHYRIVDFKRDKENIPAKVASIEYDPNRTAYIALLNYADGEKRYILAPQGLKAGDKVQTSDEPPFHIGCCMKLRLMPLGSVIHNIELYPGKGGKLVRSAGLSAQLMARSGGYATIRMPSGEVRMINENCRATFGAVSNPERNLRVEGKAGRMRWKGIRPTVRGTAMNPVDHPHGGGEGKHKGNTPQTPWGLYTKGLVTRSNKKSNKLIVKRRRKK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.973 kDa

MAIKKYKPTTNGRRNMTSIDYKATLTTSTPEKSLLAAKNSKAGRNNRGLITTRHKGGGHKQKYRIIDFKRNKRDVVGTIATIEYDPNRNAFICLVNYLDGEKRYILFAKGMTVGMKIVASEHADIKVGNAAPLKNIPEGTLIHNVELKPGKGGQMARSAGTSVQILGKDDDGKYVTLRLTSGEVRKVLADCYATIGEVGNEEYNLVNWGKAGRNRWRGIRPTVRGSVMNPNDHPHGGGEGRTPIGRKSPVTPWGKKALGVKTRNTKKPSEKLIVRKRNAKK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.156 kDa

MALKTFKPYTKSTRGTILVDRAGLWKGKPFKALVEPKNSMRGRNNNGHITSRNMSGGGHKKMYRLVDFYRKKIDMPGTVERIEYDPNRSCYIMLVKFDDGQHFYYLAPQKIKVGDKVENGSEKEIKVGNCMPLRDIPVGINIHNVELKPGAGGKIARSAGTSVTISGLDGNYSLIKMTSGEVRKIDSRCMATIGVLSNPDQKNIKIGKAGRSRWLGRRPHTRGVVMNPVDHPHGGGEGKTAGGRHPVSPTGQSAKGLKTRDNKSTDKFIVRRRNNRKDSKK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.333 kDa

MGIRKYKGTTNGRRNMNGYDFAEITKTTPEKSLLAPLKHTAGRNNAGKMTVRHRGGGTKRQYRIIDFKRIKDDVPATVKAIEYDPNRTANIALLGYADGTKSYILAPKGLKVGMTVQSGPDADIKVGNTLPLKNIPVGTVIHNIELKPGKGGQLTRSAGTSAQLLGKEEKYVLVRLSSGEVRMILAACRATIGSIGNDEHGLLVKGKAGRSRYAGQRPHVRGSVMNPNDHPHGGGEGKAPVGLPSPLSPWGKKTVGKKTRSHKARSNKFIVRGRKRGPHTR

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.094 kDa

MAIRKLNPTTNGTRNMSILDYKTNLTGHAPEKSLMKILKKNSGRNNRGVITTRHKGGREKRFYRLVDFKRNKDNIEAIVKTIEYDPNRSANISLVTYLDGEKRYILSPKGIKVGQRIVSGENVDIIVGNSLELANIPEGTNIHNIELQPKGGGILARSAGSYAQILGKEESGKYVLIRLKSGEVRKVFAKCRATIGIVGNEEHSLVNIGKAGRNRHKGIRPTVRGSVMNPIDHPHGGGEGKQPIGRKAPLTPWGKKALGVKTRDNKKSSTKLIIRRRKESK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.78 kDa

MAIKHYKPTTNGRRNMTSLDYKHNLSGDKPTKSLLRILKNSAGRNNQGKITVRHHGGRVKRFYRLVDFKRNKDNIPAVVKTIEYDPNRSANICLLAYADGEKRYIIAPKGIKVGQKVVSGEGADIIVGNSLPLSNIPEGTFIHNIEMQPGGGAKLARSAGTSAQILGKDDNGKYVVVKLKSGETRRILARCRATVGMVGNEEYSLVNVGKAGINRHRGIRPTVRGSVMNPVDHPHGGGEGKQPVGRKSPLTPWGKIALGVKTRKTKKSSNKLILRRRKDAK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.63 kDa

MGIKKYKPTSAARRLMTVSDFADITKDSPEKSLTEPLKRSGGRNVHGHITRRHQGGGHKRRYRVIDFKRRDKDGVPAKVVAVEYDPNRTANIALLHYADGEKRYILAPVGLSVGDTVFAGEGADIRPGNSLPLQNIPVGTVIHNVELKPGRGAQVIRSAGTSGQLMAKEDRYAQVRMPSGTVRKVLIECRATVGQVGNIEHEIIRIGKAGKSRWLGIRPTVRGLAMNPVDHPHGGGEGKSGQGNPHPVSPWGKKTKGLTTRTNKRTDKFIVSGRRQGARSQ

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.396 kDa

MGIKTFNPYTPSRRHMTGSDFAEITTSTPEKSLVVSLKKNAGRNNQGKITVRHQGGGSRRKYRIIDFKRKKDGISAVVKTIEYDPNRTANIALICYADGEKAYILAPNGLQVGQTVMNGATAEIKVGNCLPLANIPVGSQIHNIELYPGKGGQLVRSAGNSAQLMAREGKYATLRLPSGEMRMVPISCRATLGQVGNIDHELVTLGKAGRVRHMGIRPTVRGSVMNPNDHPHGGGEGKTGIGRPGPVTPWGKPALGLKTRKKNKQSNKMIMRRRDGKALSK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.47 kDa

MGIRKYKATTNGRRNMNGYDFAEITKTTPEKSLLAPLKHTAGRNSYGHITVRHRGGGTKRQYRIIDFKRIKDDVPATVKAIEYDPNRTANIALLVYADGTKSYIIAPKGLKVGMTVQSGPDADIKVGNALPLKNIPVGTVIHNIELKPGKGGQLARSAGASAQLLGKEEKYVLVRLSSGEVRMVLATCRATIGTVGNDEHALIIKGKAGRTRYAGQRPHVRGSVMNPNDHPHGGGEGKQPVGLPSPLSPWGKKTVGKKTRSHKARSNKFIVRGRKRGPHTR

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.47 kDa

MGIRKYKATTNGRRNMNGYDFAEITKTTPEKSLLAPLKHTAGRNSYGHITVRHRGGGTKRQYRIIDFKRIKDDVPATVKAIEYDPNRTANIALLVYADGTKSYIIAPKGLKVGMTVQSGPDADIKVGNALPLKNIPVGTVIHNIELKPGKGGQLARSAGASAQLLGKEEKYVLVRLSSGEVRMVLATCRATIGTVGNDEHALIIKGKAGRTRYAGQRPHVRGSVMNPNDHPHGGGEGKQPVGLPSPLSPWGKKTVGKKTRSHKARSNKFIVRGRKRGPHTR

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.167 kDa

MAIKKFKAYTNGRRNMSSLDYQANLSGHRPEKSLLVALPTHSGRNNQGKITTRHHGGRLKRFYRLVDFKRNKDDILATVKTIEYDPNRSANISLVVYADGEKRYIISPKGLKVGQKIISGEQVDIQIGNSLPLKNIPEGTYVHNIEMQPKQGGVIARSAGSSAQILGKDETGRYIILRLKSGEVRKILALCRATVGEVGNEEHSLVNIGKAGRNRLRGIRPTVRGSAMNPNDHPHGGGEGHQPIGRKSPMTPWGKKALGVKTRKTKKASNQFIIRRRKESK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.678 kDa

MAVKHYKPVTNGRRNMSSLDYSKNLSGHAPEKSLLVILKKNSGRNNQGKITVRHQGGRVKRYYRIIDFKRNKDDIPATVKSIEYDPNRSANICLLAYADGEKRYILAPEGIKVGQKVVSGNNVDILVGNSLPLSNIPEGTFVHNVEMQPGGGGIIARSAGTSAQILGKDDDGKYVVLRLKSGEMRRILARCRATIGTVGNGEHSLVLLGKAGRSRHLGVRPTVRGSVMNPIDHPHGGGVSKQPIGRKAPLTPWGKKALGVKTRKTKKSSTKLILRRRKDSK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.02 kDa

MAIKKYKSTTNGRRNMTTIDYSAVLTTKNTPEKSLVVSKSSKAGRNNRGLITTRHKGGGHKQKYRIIDFKRNKRDIFGTISTIEYDPNRNAFICLVNYVDGEKRYILFAKGMQVGMKVVASENADIKVGNSAPLKNIPEGTLLHNVELKPGKGGQIARSAGSSVQLLGKDDDGRYVTLRLSSGEVRKVLSECYATIGEVGNEEYNLVNWGKAGRNRWRGIRPTVRGSVMNPNDHPHGGGEGRAPIGRKSPVTPWGKKALGVKTRNTKKASEKLIVRKRSKK

rplB

50S ribosomal protein L2

281 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.018 kDa

MAIKKFKAYTNGRRNMSSLDYQANLTGHAPEKSLLVALPTKAGRNNQGKITTRHQGGRLKRFYRIIDFKRQKDGIPATVKTIEYDPNRSANISLVVYRDGEKRYILSPKGIKIGQVILSGDNVDIQVGNHLPLANIPEGTFVHNIELQPRQGGIIARSAGSSAQILGKDESGRYVILRLKSGEVRKVLAINRATVGEVGNEEHSLVNIGKAGRNRLRGIRPTVRGSAMNPNDHPHGGGEGRQPIGRKSPMTPWGKRALGVKTRATKKASNQFIIRRRKETK

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.795 kDa

MGIRKYRPMTPGTRQRSGADFAEVTKSKPEKKLTKYVHRKQGRNNQGVITSRFRGGGHKRLYRFIDFKRDKRGIPAEVLAIEYDPNRNARIALVQYTDGEKRYILHPVGLKVGARISAGEDAPIELGCALPLEKLPLGSNVHNIELLPGRGGQMARAAGAVAQLMAKEGDYATLRLPSGEVRVVRKECYATLGQVGNLDAKNISIGKAGRQRWLGKRPHNRGVVMNAVDHPHGGGEGKSPIGGKPQTPWGKSALGTKTRKRRKPSSKFIIRRRKTASGRG

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.11 kDa

MGLKKFKPITPGLRHLILPDFSEITKEEPEKSLLRPLKKSGGRNNFGHVTTRFRGGGHKRLYRIIDFRRDKDNIPAKVASIEYDPNRTARIALLHYADGEKRYIIAPEGLKVGDIVMSGENVDIKVGNNLPLKNIPDGTLIHNLELYPGRGGQLVRAAGTAAQILGKEGKWAYVRLPSGEIRLFDLNCRATIGQVSNVDHQNVSLGKAGRSRWLGRRPHVRGSAMNAVDHPHGGGEGKAPIGHPSPLTPWGKPTLGYKTRKKRKPSDRFIIQRANDKKEK

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.48 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLSKKGGRNNTGRITMRRRGGGAKRLYRIVDFKRRKFDVEGVITRIEYDPNRTAFIALVTYTDGEQAYILAPQRTAVGDKVVASQKADIKPGNAMPFSGMPIGTIVHNIELKPGKGGQIARAAGTYAQFVGRDGGYAQIRLSSGELRLVRQECMATVGAVSNPDNSNQNLGKAGRNRHKGIRPSVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRNKNKASSKLIIRSRHAKKKGR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.094 kDa

MAIRKYKPTTPGRRQSSVSMFEEITRSTPEKSLVRPLPKKGGRNVHGHITVRHKGGGHKRQYRLIDFRRNDKDGIPAKVAHIEYDPNRTANIALLHYVDGEKRYIIAPKGLQQGQMIESGVNADIKVGNNLPLRNIPAGTTIHCVELKPGAGAKLARSAGASIQLLGKAGKYAVLRMPSSEIRRVDIRCRATVGEVGNADQINIRWGKAGRMRWKGVRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKKEGRTRNPNRYSNNMIVQRRRTNKSKKR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.194 kDa

MAIRKYKPTTPGRRASSVSMFSEITRSTPEKSLLRPLSKTGGRNSHGHITTRHRGGGHKRRYRVIDFRRNDKDGVLAKVAHIEYDPNRTANIALLHYFDGEKRYIIAPKGLTQGTVVESGANADIKVGNNLPLRNIPTGTTIHNVELKPGAGAKLARSAGSSVQLLGKEGPYAILRMPSTEIRRVDIRCRATVGEVGNADQINIRWGKAGRMRWKGWRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRRPKRYSDDMIVRRRRANKNKKR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.125 kDa

MAIRKYKPTTPGRRASSVSMFTEITRSTPEKSLLRPLSKTGGRNSHGHITTRHRGGGHKRRYRVIDFRRNDKDGVLAKVAHIEYDPNRTANIALLHYFDGEKRYILAPKGLTQGTVIESGAAADIKVGNNLPLRNIPTGTTIHNVELKPGAGAKLARSAGASIQLLGKEGSYAVLRMPSSEIRRVDIRCRATVGEVGNAEQINIRWGKAGRMRWKGWRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRKPKRYSDDMIVRRRRANKNKKR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.125 kDa

MAIRKYKPTTPGRRASSVSMFTEITRSTPEKSLLRPLSKTGGRNSHGHITTRHRGGGHKRRYRVIDFRRNDKDGVLAKVAHIEYDPNRTANIALLHYFDGEKRYILAPKGLTQGTVIESGAAADIKVGNNLPLRNIPTGTTIHNVELKPGAGAKLARSAGASIQLLGKEGSYAVLRMPSSEIRRVDIRCRATVGEVGNAEQINIRWGKAGRMRWKGWRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRKPKRYSDDMIVRRRRANKNKKR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.126 kDa

MAIRKYKPTTPGRRQSSVSEFAEITRSTPEKSLLRPLSKTGGRNVHGHITTRHKGGGHKRRYRVIDFRRNDKDGVLAKVAHIEYDPNRTANIALLHYRDGEKRYIIAPRGLQQGALLESGPNADIKVGNNLPLRNIPTGTTIHAVELKPGGGAKMARSAGASIQLLGKEGKYAVLRMPSTEIRRVDIRCRATIGEVGNADQINIRWGKAGRMRWKGVRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGQPEGRTRKPNRPSDRMIVRRRRSNKNKKR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.966 kDa

MAIRKYKPTTPGRRQSSVSGFDELTRSTPEKSLLRPLHKTGGRNVHGHITTRHKGGGHKRQYRLIDFRRNDKDGVPAKVAHIEYDPNRTANIALLHYFDGEKRYIIAPRNLKQGTVVESGANADIKVGNNLPLRNIPTGTTIHAVELKPGGGAKLARSAGSSIQLLGKEGKYAILRMPSTEIRRVDARCRATVGEVGNADQINIRWGKAGRMRWKGVRPTVRGVVMNPVDHPHGGGEGKSSGGRHPVSPWGQPEGRTRKPNRPSDGLIVRRRRSNKNKKR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.484 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKALTEGLSKHGGRNNTGRITMRRKGGGAKRLYRIVDFKRNKMDVAATVERIEYDPNRTAFIALVKYEDGEQAYILAPQRLAVGDTVVASQKADIKPGNAMPFSGMPIGTIIHNIEMKPGKGGQIARAAGTYAQFVGRDGGYAQIRLSSGELRLVRQECMATVGAVSNPDNSNQNYGKAGRMRHKGVRPSVRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGAKTRNKKKASSQLIIRSRHAKKKGR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.505 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKSGGRNNTGRITSRRRGGGAKRLYRIVDFKRNKFDVAATVERIEYDPNRTAFIALIKYEDGEQAYILAPQRLAVGDKVVASAKADIKPGNAMPFSGMPIGTIVHNIEMKPGKGGQIARAAGTYAQFVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNYGKAGRMRHKGIRPSVRGVAMNPIDHPHGGGEGRTSGGRTPVTPWGKDTKGTRTRNKNKASQKLIIRSRHAKKKGR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.548 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKSGGRNNTGRITSRRRGGGAKRLYRIVDFKRNKFDVAATVERIEYDPNRTAFIALVKYEDGEQAYILAPQRLAVGDKVIASAKADIKPGNAMPFSGMPIGTIVHNIEMKPGKGGQIARAAGTYAQFVGRDGGYAQIRLSSGELRLVRQECMATVGAVSNPDNSNQNYGKAGRMRHKGKRPSVRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRNTNKASQKLIIRSRHAKKKGR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.437 kDa

MAIRKYKPTSPGRRGASVSDFSEVTRSTPEKSLVRPLHGHGGRNAHGRITTRHKGGGHKRAYRVIDFRRNDKDGVNAKVAHIEYDPNRTANIALLHFLDGEKRYIIAPQGLSQGDVVESGPNADIKPGNNLPLRNIPAGTVIHAVELRPGGGAKLARSAGSSIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRHPNKASNKLIVRRRRTGKKHGR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.571 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKKGGRNNTGRITARRRGGGAKRLYRIVDFKRTKFDVSATVERIEYDPNRTAFIALVRYEDGEQNYILAPQRLGVGDKVVASKKADIKPGNAMPFSGLPIGTIVHNIELKPGKGGQIARAAGTYAQFVGRDGGYAQIRLSSGELRLVRQECMATVGAVSNPDNSNQNLGKAGRVRHMGKRPSVRGVAMNPIDHPHGGGEGRTSGGRTPVTPWGKDTKGRRTRDKNKASQKLIIRSRHAKKKGR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

31.122 kDa

MGLKKFKPITPGLRHLILPDFSEITKEEPEKSLLKPLKKSGGRNNFGHVTSRFRGGGHKRLYRIIDFRRDKDNIPAKVASIEYDPNRTARIALLHYADGEKRYIIAPEGLKVGDIIMSGENVDIKIGNNLPLKNIPDGTLIHNLELYPGRGGQLVRAAGTAAQILGKEGKWAYVRLPSGEIRLFDLNCRATIGQVSNVDHQNVSLGKAGRSRWLGRRPHVRGSAMNPVDHPHGGGEGKAPIGHPSPLTPWGKPTLGYKTRKKRKPSDRFIIQRANDKKEK

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.577 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNANKSSNKFIVRRRRTGKKHSR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.577 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNANKSSNKFIVRRRRTGKKHSR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.577 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNANKSSNKFIVRRRRTGKKHSR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.359 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGHGGRNAHGRITTRHKGGGHKRAYRVIDFGRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLVHAVELRPGGGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNPNKASNKLIVRRRRTGKKHGR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.731 kDa

MPVRILKPRTPGTRFFSYPSFEEITTDKPEKSLLVPNKSTGGRNNNGRVTSRHMGGGHKRYYRIIDFKRNKDGIPAKVATIEYDPNRTARIALLSYADGEKRYILAPNGIKVGDLIECGPEADIKVGNALPLKNIPVGIEVHNIEMRPGKGGQMARSAGSYAVLVAKEGDYATLKMPSGELRKVRVECKATVGVIGNLEHENLSLGKAGRSRWLGIRPQTRGMAMNPVDHPMGGGEGKSKSGGGRKHPKSPWGQKSKGLKTRKRKKASSKLIVRRRDSKK

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.577 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNANKSSNKFIVRRRRTGKKHSR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.577 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNANKSSNKFIVRRRRTGKKHSR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.577 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNANKSSNKFIVRRRRTGKKHSR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.555 kDa

MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRITTRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDGKKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKSSNKLIVRRRRTGKKHAR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.555 kDa

MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRITTRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDGKKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKSSNKLIVRRRRTGKKHAR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.458 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGHGGRNAHGRITTRHKGGGHKRAYRVIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLVHAVELRPGGGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNPNKASNKLIVRRRRTGKKHGR

rplB

50S ribosomal protein L2

280 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.394 kDa

MAIRKYKPTSPGRRGASVSDFSEVTRSTPEKSLVRPLHGHGGRNAHGRITTRHKGGGHKRAYRVIDFRRNDKDGVNAKVAHIEYDPNRTANIALLHFLDGEKRYIIAPQGLSQGDVVESGPNADIKPGNNLPLRNIPAGTVIHAVELRPGGGAKLALSAGSSIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRHPNKASNKLIVRRRRTGKKHGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.46 kDa

MSVRKLKPITPGQRFRVVNGYDAITTDKPEKSLLAPIKKSGGRNSQGKMTMRYKGGGHKKRYRVIDFKRDKQGIPATVASIEYDPNRTAFIALLNYQDGEKRYIIAQNGLQVDQNVVSSNEAATPEIGNAMPLANIPLGTVISCIELRPGQGAVMARSAGAFAQLLAREGKYATIKLPSGEIRRVLALCMATIGAVSNSDHQLMIGGKAGRSRWLGIRPRTRPVAMNPVDHPMGGGEGRASGGHPRSRKGLPAKGFKTRSRTKASNKYIVERRKTRKKK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.159 kDa

MPVKNLKPFNASSRGAVLVDYSELWRGSPEKKLLLPKKSCSGRNNAGRITVRHRGGRGKVRYRLISFSRFSSGAPLFTKAVVERIEYDPNRTAFIALVRDFKTGLPSYIIAPEGLKKSDVLSTDVFDDMAPGACMPLGKVPLGTTVHNVELKPGAGGQLVRSAGSSARVIARDGNYTLVTLPSGEKRLILSTCHATIGAVSNADRKNTKLGKAGRSRWLGRRPSVRGVAMNPVDHPMGGGEGKTSGGRHPVSPWGFPTKGKKTRDPNKLSSKFIKSKKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.553 kDa

MAIRKYKPTTPGRRGSSVADFAEITRSTPEKSLLTPLPKKGGRNAHGRITARHQGGGHKRQYRIIDFKRVDKDGVPAKVAHIEYDPNRTARIALLHFLDGEKRYILAPKDLKQGDIVESGPGADIKPGNNLPLRNIPVGMTIHNVELRPGGGAKLARSAGTGIQLLGREGAYATLRMPSGEIRRVDVRCRASIGEIGNADQSNINWGKAGRMRWKGKRPTVRGVAMNPVDHPHGGGEGKTSGGRHPVNPQGKPEGRTRRKGQPSDRLIVRRRYATRKRG

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.119 kDa

MAIKTYKPTTNGRRNMSGFDFSVITKTTPEKSLLAKKSKTGARNAEGRMTVRHHGGGHKQQYRIIDFKRIKDDKTATVKAIEYDPNRTANIALLVYEDGVKSYILAPKGLEAGTKVQSGPDADIKVGNALPLGNIPEGTLIHNIELKPGKGGQLARSAGTSAQILGKDDAGKYVIIRLSSGEVRMIPATSRATIGEVGNAEHSLISWGKAGRSRWRGKTPHVRGSVMNPNDHPHGGGEGKAPVGHPSPMSPWGKKSYGKKTRDKKKPSTKFIVRGRKGK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.659 kDa

MGIRKYKPTTPGRRGSSVADFAEITRSTPEKSLLRPLHKTGGRNNSGKITTRHKGGGHKRQYRLIDFRRHDKDGINARVAEIEYDPNRTARIALLHYVDGTKRYIIAPNKLSQGDFVEAGPDADIKPGNNLPLRNIPVGTVIHAVELRPGGGAKMARSAGASVQLVAKEGRFAQLRLPSGEIRNVDVRCRATVGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVAMNPVDHPHGGGEGKTSGGRHPVNPNGKPEGRTRRPNKESDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.399 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKNGGRNNTGRITMRRKGGGAKRLYRIVDFKRTKFDVSATVERIEYDPNRTAFIALIKYEDGEQAYILAPQRLAVGDKVIAGAKVDVKPGNAMPFSGMPIGTIVHNVELKPGKGGQIARSAGTYAQFVGRDGGYAQIRLSSGELRLVRQECMATIGAVSNSDHSNQNFGKAGRNRHKGIRPSVRGVAMNPIDHPHGGGEGRTSGGRHPVTPWGKGTKGTRTRSNKSTDKYILRSRHAKKKGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.59 kDa

MPARRYKPTSPGRRNSSVLTRDSVTKEKPEKSLLAKLHKTGGRNVHGRITTRHKGGGHKRRYRIIDFKRNKDGVPATVAAIEYDPNRSANIALLHYHDGEKRYILAPRNLTVGSVVMSGPEAEVDVGNALPLANIPVGTTVHAVELEPGRGAQLARSAGTSAQIIAREGNLVTLRLPSGERRRVRAECRATVGVVGNQSHQNVRWGKAGRKRHLGIRPTVRGTVMNPVDHPHGGGEGKSTPGRAPVTPWGKITQGKPTRKKRKRSDAMIVARRKKGRRR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.535 kDa

MAIRKYRPTTPGRRGSSVADFAEITRSTPEKSLLAPLPKKGGRNAHGRITTRHQGGGHKRQYRIIDFKRVDKDGVPAKVAHIEYDPNRTARIALLHFLDGEKRYIVAPKDLKQGDIVESGPGADIKPGNNLPLRNIPVGTTIHNVELRPGGGAKLARSAGVGIQLLGREGAYATLRMPSGEIRRVDVRCRASIGEIGNADQSNINWGKAGRMRWKGKRPTVRGVAMNPVDHPHGGGEGKTSGGRHPVNPQGKPEGRTRRKGQPSDRLIVRRRYATRKRG

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.777 kDa

MPIKTFRPYTPSRRTITVADFSEITTKTPEKRLVKGLRKTGGRNNTGMIMVRHIGGGHKRAYRQIDFKREKYGVPAKVATIEYDPNRNARICLLHYADGDKRYIIHPVGLKIGDEVMSGPNAEIKVGNCLPLKNIPEGTFIHALELKVGKGAQLVRSAGSQAQLMAKENDYAHVKMPSGEIRLVPIACCASIGQVGNVEHNNIVIGNAGRKRHRGVKPTVRGSAMNAVDHPMGGGRGHSKGGNIPRSPWNQPSRGLKTRPKKSWDWMIVSDRRKNKAGK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.513 kDa

MALKTFNPVTPSLRQLVIVDRSDLYKGKPLKQLTEGKSSSGGRNNNGRITVRFRGGGHKQTYRIIDFKRRKLDVAAKVERIEYDPNRTSFIALIRYADGEQSYIIAPQRLSVGDEVVSSQQADVKPGNAMPLASMPVGTIVHNIEMKIGKGGAMVRSAGTFAQVVGRDQGYVIIRLNSGEQRLIHGQCFATVGAVSNPDHMNASIGKAGRSRWLGRRPHNRGVTMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTTKFIVTSRHKSKKKG

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.608 kDa

MAIRKYKPTTPGLRGSSVADFAEITRSTPEKSLLRPLHKTGGRNNTGRITTRHKGGGHKRQYRLVDFRRHDKDGVPATVAHIEYDPNRTARIALLHYADGAKRYILAPAKLKQGDVVEAGPNADIKPGNNLPMRNIPVGTTIHAVELRPGGGAKMARSAGASVQLVAREGKYAQLRLPSGEIRNVDVRCRATIGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVNRNGKPEGRTRRPNKESDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.845 kDa

MALKQYNPVTPGMRNLVLVDRSDLYKGKPVKKLTEGLVKTGGRNNHGRVTSWWRGGGNKRRYRLIDFKRTKVDVAGRVERLEYDPNRTAFIALITYEDGEQTYILAPQRLQVGDAVISADRADIKPGNAMPLKNMPVGTIIHNVEMKPGKGGQLARSAGCYAQLIGKDAGYAQLRLSSGELRLVRGECLATVGAVSNPDNQNEKLGKAGRSRWMGRRPHVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKKTDSLIMRSRHLAKKKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.369 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKTLVEGLIKTGGRNNTGRVTMWHKGGGAKRLYRIVDFKRRKFDVPAVVERIEYDPNRTAFIALVRYEDGELAYILAPQRLAVGDSVVAGVKTDVKPGNAMPFSGMPIGTIVHNVELKPGKGGQLARAAGTYAQFVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNFGKAGRMRHKGVRPTVRGVAMNPIDHPHGGGEGRTSGGRHPVTPWGKGTKGNRTRKSKASDKLIVRSRHAKKKGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.369 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKTLVEGLIKTGGRNNTGRVTMWHKGGGAKRLYRIVDFKRRKFDVPAVVERIEYDPNRTAFIALVRYEDGELAYILAPQRLAVGDSVVAGVKTDVKPGNAMPFSGMPIGTIVHNVELKPGKGGQLARAAGTYAQFVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNFGKAGRMRHKGVRPTVRGVAMNPIDHPHGGGEGRTSGGRHPVTPWGKGTKGNRTRKSKASDKLIVRSRHAKKKGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.355 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKTLVEGLIKTGGRNNTGRVTMWHKGGGAKRLYRIVDFKRRKFDVPAVVERIEYDPNRTAFIALVRYEDGELAYILAPQRLAVGDSVIAGAKTDVKPGNAMPFSGMPIGTIVHNVELKPGKGGQLARAAGTYAQFVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNFGKAGRMRHKGVRPTVRGVAMNPIDHPHGGGEGRTSGGRHPVTPWGKGTKGNRTRKSKASDKLIVRSRHAKKKGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.369 kDa

MALKSYKPTTPGQRGLVLIDRSELWKGRPVKTLVEGLIKTGGRNNTGRVTMWHKGGGAKRLYRIVDFKRRKFDVPAVVERIEYDPNRTAFIALVRYEDGELAYILAPQRLAVGDSVVAGVKTDVKPGNAMPFSGMPIGTIVHNVELKPGKGGQLARAAGTYAQFVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNFGKAGRMRHKGVRPTVRGVAMNPIDHPHGGGEGRTSGGRHPVTPWGKGTKGNRTRKSKASDKLIVRSRHAKKKGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.873 kDa

MAVKRIKNHSSGKRQTVVVDYKSILTTSKPEKSLLVTLPKKAGRNNQGKITIRHHGGGHKRKYRIIDFKRNKDNIYGTIKSIEYDPNRTSFISLVVYADGEKRYIIAPKGIKVGDKIISGNENIDILLGNSLPLEFIPEGTLVHNIELSPNAGGQITRSAGASAQILGFDETKKYILVKLNSGEVRKFRKECRATIGTVSNDEHILENLGKAGKSRHLGVRPTVRGSAMNPNDHPHGGGEGRSPVGMDAPRTPWGKRHMGVKTRNNKKSSTSMIVRRRK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.873 kDa

MAVKRIKNHSSGKRQTVVVDYKSILTTSKPEKSLLVTLPKKAGRNNQGKITIRHHGGGHKRKYRIIDFKRNKDNIYGTIKSIEYDPNRTSFISLVVYADGEKRYIIAPKGIKVGDKIISGNENIDILLGNSLPLEFIPEGTLVHNIELSPNAGGQITRSAGASAQILGFDETKKYILVKLNSGEVRKFRKECRATIGTVSNDEHILENLGKAGKSRHLGVRPTVRGSAMNPNDHPHGGGEGRSPVGMDAPRTPWGKRHMGVKTRNNKKSSTSMIVRRRK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.931 kDa

MAVKRIKNHSSGKRQTVVVDYKSILTTSKPEKSLLVTLPKKAGRNNQGKITIRHHGGGHKRKYRIIDFKRNKDNIYGTIKSIEYDPNRTSFISLVVYADGEKRYIIAPKGIKVGDKIISGNENIDILLGNSLPLEFIPEDTLVHNIELSPNAGGQITRSAGASAQILGFDETKKYILVKLNSGEVRKFRKECRATIGTVSNDEHILENLGKAGKSRHLGVRPTVRGSAMNPNDHPHGGGEGRSPVGMDAPRTPWGKRHMGVKTRNNKKSSTSMIVRRRK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.695 kDa

MGIRKYKPTTPGRRGSSVADFTEITRSTPEKSLVRPLPKKGGRNNTGKITTRHKGGGHKRQYRLIDFRRHDKDGVDARVAEIEYDPNRTARIALLHYVDGTKRYIIAPNKLSQGDFVEAGANADIKPGNNLPLRNIPVGTVIHAVELRPGGGAKMGRSAGASIQLVAKEGRFAQLRLPSGEIRNVDVRCRATVGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVAMNPVDHPHGGGEGKTSGGRHPVNPNGKREGRTRRPNKESDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.148 kDa

MSLKKFRPITPGTRFRVAASYDDVTTSTPEKSLVVSIKKSGGRNSQGKMTMRYIGGGHKQQYRIIDFKRDKHAIPAVVKTIEYDPNRTARIALLSYADGEKRYIIAPTGLEVGNTILSGPGIAPEVGNCLPLSDIPLGTVVHNIELKPGKGAAMARSAGTYAQLVAREGKYATLKLPSGEMRMVLVVCYASIGTVSNADHMNLTKGKAGATRWAGRRPRVRGVAMNPVDHPMGGGEGRSSGGHPRSRKGLYAKGGKTRSANKYSKNMIVKKRVNKRLSK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.712 kDa

MGIKKFKPVTSASRYKSVLDFKEITETEPYKPLTLTLSYKAGRGDGGKISVRHKGGRVKRKYRIIDFKRRKTNVSAVVKTLEYDPNRSAFISLICYKDGEYAYILAPDGIKVGDTVQSGAGSEIKIGNAMPIGKIPPGTNVHNVELQIGRGGQIARTAGSFGTIAGRDGEYILLKLPSTEVRKVHENCYATIGICSNKDHNLVSIGKAGRSRWLGKRPTVRGVVMNPVDHPHGGGEGRTSGGRHPVSPWGQPTKGYKTRRSARPSDKFIVQKRKRNRNR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.65 kDa

MGIKKFKPVTSASRYKSVLDFAEITETEPYKPLTLTLNYKAGRGDGGKIAVRHKGGRVKRKYRIIDFKRRKANIPAVVKSLEYDPNRSAFISLICYKDGEYSYILAPDGIKVGDTVQSGAGSEIKIGNAMPIGKIPPGTNVHNVELQIGKGGQIARTAGSFGTIAGRDGEYILLKLPSSEVRKVHENCYATIGICSNKDHNLVSIGKAGRSRWLGKRPSVRGVVMNPVDHPHGGGEGRTSGGRHPVSPWGQPTKGYKTRRSTRPSDKFIIQKRKRNRNR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.65 kDa

MGIKKFKPVTSASRYKSVLDFAEITETEPYKPLTLTLNYKAGRGDGGKIAVRHKGGRVKRKYRIIDFKRRKANIPAVVKSLEYDPNRSAFISLICYKDGEYSYILAPDGIKVGDTVQSGAGSEIKIGNAMPIGKIPPGTNVHNVELQIGKGGQIARTAGSFGTIAGRDGEYILLKLPSSEVRKVHENCYATIGICSNKDHNLVSIGKAGRSRWLGKRPSVRGVVMNPVDHPHGGGEGRTSGGRHPVSPWGQPTKGYKTRRSTRPSDKFIIQKRKRNRNR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.423 kDa

MAIRKLRPVTPASRYLSYPEFDEITKSEPEKSLLAPLKKSGGRNKAGRITSRHRGGGHKRFYRIIDFKRNKDNIPATVAAIEYDPNRSARIALLHYVDGEKRYILAPKGLKVGEQLLSGDKVEVKPGNTMPLKNIPLGTDIHNIEMKAGKGGQIVRSAGAYAVLAAKEGDYATLKLPSGEIRKVRIECRATIGGVGNADHENIVLGKAGRSRWLGVRPQTRGMAMNPVDHPMGGGEGKSKSGGGRKHPKSPWGQLAKGLKTRNKKKASSKLIVRGRKSK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.113 kDa

MALKHFNPTSPGQRGLVLIDRSELHKGRPEKKLVEGLTKSGGRGGNGRIAVRFRGGGAKRLYRLVDFKRRKQGVATVVRLEYDPNRTAFIALIKYQADGELAYILAPQRLKAGDEVVTADKVDVKPGNTSPLRTMPIGTIIHNVELKPAKGGQIARSAGAYAQLVGRDAGYAQIRLNSGELRMVLDTCLATVGAVSNPDHSNQNLGKAGRVRHMGRRPHVRGVAMNPVDHPHGGGEGRTSGGRNPVTPAGKPTKGAKTRVNKATDKFIIRSRHKAKKGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.157 kDa

MALKQFNPTSPGQRGLVLIDRSELHKGRPEKKLVEGLTKSGGRGGNGRIAVRFRGGGAKRLYRLVDFKRRKQGVATVVRLEYDPNRTAFIALIKYQADGELAYILAPQRLKAGDEVVTAEKVDVKPGNASPLRTLPIGTIIHNIELKPAKGGQIARSAGAYAQLVGRDAGYAQIRLNSGELRMVLDTCMATVGAVSNPDHMNQNLGKAGRSRHMGRRPHVRGVAMNPVDHPHGGGEGRTSGGRHPVTPAGKPTKGAKTRVNKATDKFIIRSRHKAKKGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.157 kDa

MALKQFNPTSPGQRGLVLIDRSELHKGRPEKKLVEGLTKSGGRGGNGRIAVRFRGGGAKRLYRLVDFKRRKQGVATVVRLEYDPNRTAFIALIKYQADGELAYILAPQRLKAGDEVVTAEKVDVKPGNASPLRTLPIGTIIHNIELKPAKGGQIARSAGAYAQLVGRDAGYAQIRLNSGELRMVLDTCMATVGAVSNPDHMNQNLGKAGRSRHMGRRPHVRGVAMNPVDHPHGGGEGRTSGGRHPVTPAGKPTKGAKTRVNKATDKFIIRSRHKAKKGR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.438 kDa

MAIRKLAPVTPGSRFMSYPVFDEITKSKPEKSLLEPLTKSGGRNSAGRKTSRHRGGGHKRHYRIIDFKRNKDGIVATVAAIEYDPNRSARIALLHYIDGEKRYILAPKGLKVGDKVESGEKVEIKTGNTMPMKNIPLGTDIHNIEMKAGKGGQIVRSAGAFAVLAAREGDYVTLKLPSGEIRKVRVECRATIGVIGNADHENIDLGKAGRSRWLGIRPQTRGMAMNPVDHPMGGGEGKSKSGGGRKHPKSPWGQLAKGLKTRNRKKASQKLIVRGRNAK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.398 kDa

MAVRKLAPNTPGTRFASYASFEEITKSEPEKSLLVPLKKSGGRNTNGRITSRHMGGGHKRFYRLIDFKRNKDNVPAKVAAIEYDPNRSARIALLHYVDGEKRYILAPKGLKVGDRIESGEKVDIRVGNTMPLKNIPLGTDVHNIEMKAGKGGQMARSAGSYAVLAAREGVHATLKLPSGEIRKVRVECRATIGVIGNSEHENISLGKAGRSRWLGIRPQTRGMAMNPVDHPMGGGEGKSKSGGGRKHPKSPWGQLAKGQKTRNKKKASTKLIVRGRKAK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.271 kDa

MAIRKLGPVTPASRYLSYSKFEEVTKSTPEKSLLAPLKKSGGRNRAGRITSRHKGGGHKRFYRIIDFKRSKDNIPAKVAAIEYDPNRSSRIALLHYADGEKRYILAPKGLKVGDVLHSGDKVDIKVGNSMPLKNIPLGADVHNIELKQGKGGQMARSAGAFATLAAKEGDHATLKLPSGEIRKVRIECRATIGGIGNDDHENIVLGKAGRSRWLGIRPQTRGMAMNPVDHPMGGGEGRSKSGGGRKHPKSPWGQLAKGLKTRNKKKASSKLIVRGRKAK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.462 kDa

MAIRKLAPVTPGSRFMSYPGFDEITKSEPEKSLLVPVKRTGGRNRAGRITSRHMGGGHKRHYRIIDFKRNKDGVPATVASIEYDPNRSSRIALLHYNDGEKRYILAPKGLKVGEKVESGEKVEIKTGNTMPLKNIPLGTDIHNVEMRAGKGGQIVRSAGAFAVLAAREGDYVTLKLPSGEIRKVRVECRATIGVVGNAEHENIVLGKAGRSRWLGIRPQTRGMAMNPVDHPMGGGEGKSKSGGGRRHPKSPWGQLAKGLKTRNKKKASQKLIVRGRNAK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.702 kDa

MAIRKHKPTTPGRRGSSVADFVEITRTTPEKSLVRPLPKKGGRNNTGRITTRHKGGGHKRQYRVIDFRRHDKDGVDAKVAHIEYDPNRTARIALLHYVDGTKRYIIAPNRLQQGDVVESGPNADIKPGNNLPLRNIPVGTVLHAVELRPGGGAKLARSAGASVQLVAREGKYGQLRLPSGEIRNVDVRCRATIGEVGNAEQSNINWGKAGRNRWKGVRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVNPNGKPEGRTRRPNKESDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.712 kDa

MGIRKYKPTTPGRRGSSVADFTEITRSTPEKSLVRPLPKKGGRNNTGKITTRHKGGGHKRQYRLIDFRRHDKDGVDARVAEIEYDPNRTARIALLHYVDGTKRYIIAPNKLSQGDFVEAGPNADIKPGNNLPLRNIPVGTVVHAVELRPGGGAKMGRSAGASIQLVAREGRFAQLRLPSGEIRNVDVRCRATVGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVAMNPVDHPHGGGEGKTSGGRNPVNPNGQREGRTRRPNKESDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.523 kDa

MAIKSYKPTTPSRRFYTNVENNDITSKPSVRSLLVKLPASAGRNNNGRITSRHREAGAKKLYRIIDFKRDKFGIAGTVSTVEYDPYRNCRIALITYVDGEKRYILLPKGLNVGDAIIADATGVDIKPGNAMKLMNIPVGTSVHNIELKVGKGGQMVRSAGTSAQIMGRDGKYVSLRMPSSEMRLVLGECMATVGAVGNEEYINIVLGKAGRTRHMGIRPQTRGSAMNPIDHPHGGGEGKTNSGRHPVTPWGKPTKGSKTRRKKASDKLIITRRKSNPKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.626 kDa

MALKTFKPITPSLRQLVIVDRSNLYKGKPVKQLTEGKSSSGGRNNNGRVTVRFRGGGHKQTYRIIDFKRRKLDMPAKVERIEYDPNRTSFIALIRYADDELSYIIAPQKLAVGDEVISGQQVDVKPGNAMALANMPVGTIVHNIEMKIGKGAAMVRSAGTYAQVVGRDQGYVIVRLNSGEQRLIHGQCFATVGAVSNPDHMNASIGKAGRSRWLGRRPHNRGVTMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRTNKSTDKFIVTSRHKSKKKG

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.837 kDa

MPIRRVKARSSGIRQTVIIDYKKVLTTSTPEKSLVVSLKKHSGRNNNGKITVRHHGGGYKKKYRIIDFKRDKINKVATVKSIEYDPNRTSFISLVVYEDGEKRYIIAPKDLKIGDRILSSNKQIDIKVGNALPISLIPEGTFVHNIELYPGRGGQMIRSAGSSAQILGKDETGEYTIVKLSSGEVRKIANGCMATIGVVSNEDHNLVVIGKAGTNRHRGIRPTVRGSAMNPNDHPHGGGEGRSPVGHDAPRTPWGKRHMGVKTRNKKKQSNALIIRRKK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.373 kDa

MAIRKLAPVTPGTRFASYAGFDEITKSTPEKSLLVPIKRTGGRNSTGRVTSRHMGGGHKRFYRIIDFKRNKDNVPAKVAAIEYDPNRSARIALLHYVDGEKRYILAPKNLKVGDRIESGEKVDIKVGNTMPLKNIPIGSDVHNIELKIGKGGQIARSAGAYAVLAAREGNYATLKMPSGEIRKVRIECRATIGVIGNAEHENISLGKAGRSRWLGIRPQTRGMAMNPVDHPMGGGEGKSKSGGGRKHPKSPWGQLAKGLKTRNKKKASTKLIVRGRKAK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.53 kDa

MAIRKYKPTTPGRRGSSVADFAEITRSTPEKSLLRPLPKHGGRNNAGRITTRHIGGGHKRQYRVIDFKRNDKDGVLATVAHIEYDPNRTARIALLHFIDGSKRYIIAPNKLKQGDKIESGPQADIKPGNNLPLRNIPTGTVIHAIELRPGGGAKMGRSAGASVRLVAKDGPYAQLRLPSGEIRNVDARCRATIGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVAMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRHINKPSDKLIVRRRNAGKKRK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.518 kDa

MAIRKYKPTTPGRRGSSVADFAEITRSTPEKSLLRPLPKHGGRNNAGRITTRHIGGGHKRQYRVIDFKRNDKDGVLATVAHIEYDPNRTARIALLHFIDGTKRYIIAPNKLKQGDKIESGAQADIKPGNNLPLRNIPTGTVIHAIELRPGGGAKMGRSAGASVRLVAKDGPYAQLRLPSGEIRNVDARCRATIGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVAMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRHINKPSDKLIVRRRNAGKKRK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.192 kDa

MGIKKYKPTTNGRRNMTASDFSEITKTKPEKSLLDSQSHTAGRNSYGHITVRHRGGGHKQQYRLVDFKRIKDEVPATVKAIEYDPNRTANIALLVYADGVKSYILAPKGLEVGMQVQSGAEADIKVGNALPLTNIPVGTVIHNIELKPGKGGQLARSAGTSAQLLGKEGKYAIVRLSSGEVRLVLLTSRATIGTVGNEQHELINSGKAGRTRWQGKRPTVRGSVMNPNDHPHGGGEGKAPIGHPSPMSPWGKKTLGKKTRNKKARSNKLIVRGRRPGKH

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.287 kDa

MAIRNYKPTTPGRRGSSVADFAEITRSNPEKSLLRPLSKSGGRNNQGRITTRHIGGGHKRQYRVIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHFLDGTKRYILAPAGLKQGNIVESGAGADIKPGNNLPLCNIPTGTVVHAIELKPGGGAKLARSAGSSVRLVAKDGPYAQLRLPSGEVRNVDARCRATIGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVAMNPIDHPHGGGEGKTSGGRHPVSPWGQKEGRTRHPNKESDKLIVRRRNAGKKRK

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.639 kDa

MGIRKYKPTTPGRRGSSVADFAEITRSTPEKSLVRPLPKSGGRNNSGKITTRHKGGGHKRQYRLIDFRRHDKDGVNAKVAEIEYDPNRTARIALLHYVDGTKRYIIAPNKLKQGDFVEAGPSADIKPGNNLPLRNIPVGTTIHAVELRPGGGAKMARSAGASVQLVAKEGRFAQLRLPSGEIRNVDVRCRATVGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVSMNPVDHPHGGGEGKTSGGRHPVNPNGKREGRTRRPNKESDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

279 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.515 kDa

MAIRKYKPTTPGRRGSSVSDFAEITRDHPEKSLIRPLHGKGGRNAHGRITTRHKGGGHKRAYRVIDFRRHDKDGVDAKVAHIEYDPNRTANIALLHYLDGEKRYIIAPQGLKQGAIVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKMARSAGASIQLLGKEGTYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKASDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.462 kDa

MMALRKTKPTSPGRRAVIKSVNSFIYKGKPFAALTEKKKKNAGRNNSGRITVRHIGGGHKQHYRIVDFCRNKDDIPAKVERIEYDPNRSAYIALLCYADGERRYIIAAKDIEVGSYLVSGSSSPIKMGNAMPIRNIPVGSVIHCIELRPGKGAQLARSAGSSAQLMAKEGDYSQIRLRSGEIRKIHISCRATIGEVSNSEHNLQSIGKAGAIRWRGVRPTVRGVAMNPIDHPHGGGEGKTAAGRHPVSPWGTPSKGSRTRKNKRTSNMIVRSRYSKKG

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.484 kDa

MAIRKYKPTTPGRRGSSVSDFAEITRSTPEKSLLRPLTKSGGRNAHGRITTRHRGGGHKRAYRVIDFRRLDKDGIPAKVAHIEYDPNRTANIALLHYVDGEKRYILAPKGVTQGTPIESGPTADIKPGNNLPLRNIPTGTTIHNVELRPGGGAKLARAAGMSIQLLGKEGPYATLRMPSGEIRRVDVRCRATVGEVGNAEQSNINWGKAGRMRWKGRRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGQPEGRTRKPNRPSDKLIVRRRKTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.692 kDa

MAIRKYKPTTPGRRGSSVADFVEITRTTPEKSLTRPLPKKGGRNNQGRITTRHQGGGHKRAYRLIDFRRYDKDGVPAKVAHIEYDPNRTARIALLHYVDGEKRYIIAPKDLTQGTRVESGPNADIKPGNNLPLRNIPVGTTIHCVELRPGGGAKIARSAGNSAQLVAREGSRATLRMPSGEMRFVDVRCRATVGEVGNAEQSNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGQPEGRTRKRKASDSQIIRRRKTGKNKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.508 kDa

MALKSYNPTSPARRGLVLVDKSALWKGKPVKALTEGKRKTGGRNNKGHVTSRGIAGGHKQKYRYVDFKRRKWDMPATVERLEYDPNRTAFIALVKYEDGELAYILAPQRLGVGDQVIAGEKTDVKPGNAMLLSQMPVGTIIHNVEMKPGKGGQIARSAGTYVQLVGRDRGMVIVRLNSGEQRYLRGDCMGTVGAVSNPDNGNQNLAKAGRNRWLGKRPLTRGVAKNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRHNKATDKMIIRSRHAKKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.543 kDa

MALKHYNPTSPARRGLILVDRSSLWKGSPVKALTEGKNKTGGRNNKGHRTSRGIGGGHKQKYRLVDFKRRKWDMPATVQRIEYDPNRSAFIALVEYEDKTLSYILAPQRLGVGDSIVASRKADVKPGNAMEIGQAPLGTIVHNIELKPSKGGQLARAAGAYAQIVGRDKGMVMIRLNSGEQRYIRSDCMVTVGAVSNSDNANQNFAKAGRNRWLGRRPLTRGVAKNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRSNKATDKFIIRSRHAKKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.604 kDa

MALKTFNPTTPGQRQLVMVDRSALYKGKPLKKLTEGKHSNGGRGNTGRITVRFRGGGHKQTYRLIDFKRTKVDVPATVERLEYDPNRTAFIALIKYADGELSYILAPQRLAVGDTVVAGSYVDVKPGNAMPMGNMPVGTIVHNVEMKIGKGGQMARSAGTYAQIVGRDHDYVILRLNSGEQRMVHGRCMATIGAVSNHDHMNTSIGKAGRTRWLGRRPHNRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTNKFILISRHKRKKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.422 kDa

MALKKYKPTSPAQRGLVLVDRSALYKGKPVKDLTEGLTKSGGRNNHGRITVRFRGGGHKRSYRTVDFKRRRYDVPATVERLEYDPNRTAFIALVKYEDGELAYILAPQRLQPGDVVISGSRVDVKPGNAMPLANIPVGTIVHNVEMKPGKGGQIARSAGTYVQLVGRDQGYALLRLSSGEQRMVPATCMASIGAVSNPDHSNITIAKAGRNRWLGKRPHVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRANKATDKYIVRSRHQKKKG

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.377 kDa

MGIRKYKPTTPGRRGSSVADFVEVTRSTPEKSLVRPLHSKGGRNNAGRVTVRHQGGGHKRAYRVIDFRRHDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRYILAPRNLQQGDRVENGPGADIKPGNNLALRNIPVGTTVHAIELRPGGGAKFARSAGASVQLLAREGAMATLRMPSGEIRMVDARCRATVGEVGNAEQSNINWGKAGRKRWLGVRPTVRGVAMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRSPKKASSKYIVRRRKTNKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.551 kDa

MGIRKYKPTTPGRRGSSVADFVEVTRSTPEKSLVRPLHSKGGRNNAGRVTVRHQGGGHKRAYRVIDFRRHDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRYILAPRNLQQGDRVENGPGADIKPGNNLALRNIPVGTTIHAIELRPGGGAKFARSAGASVQLLAKEGTMAHLRMPSGEIRLVDQRCRATVGEVGNAEQSNINWGKAGRKRWLGVRPTVRGVVMNPVDHPHGGGEGRTSGGRHPVSPWGKKEGRTRSPKKASNKYIVRRRKTNKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.493 kDa

MAIRKYKPTTPGRRGASVADFVEVTRSTPEKSLVRPLHSKGGRNNAGRITVRHQGGGHKRAYRIVDFRRHDKDGVPAKVAHIEYDPNRSARIALLHYADGEKRYILAPRNLQQGDRVENGPGADIKPGNNLALRNIPVGTTIHAIELRPGGGAKFARSAGASVQLLAKEGAYAHLRMPSGEIRLVNVRCRATIGEVGNAEQSNINWGKAGRKRWLGVRPTVRGVVMNPVDHPHGGGEGRTSGGRHPVSPWGKPTGRTRSNKKASNKYIVRRRTKNKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.416 kDa

MGIRKYKPTTPGRRGSSVADFVEITRSTPEKSLVRPLHSKGGRNNAGRVTVRHQGGGHKRAYRVIDFRRHDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRYIVAPRGLSQGDRVENGPTADIKPGNNLALRNIPVGTTIHAIELRPGGGAKFARSAGASVQLLAKEGTMAHLRMPSGEIRLVDARCRATIGEVGNAEQSNINWGKAGRMRWKGVRPTVRGVAMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRSPKKASNKYIVRRRKTNKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.421 kDa

MALKSFNPTTPSQRQLVIVDRASLYKGKPVKALTQGLSSKGGRNNQGRITVRFQGGGHKRTYRLVDFKRRKFDVEGTVERLEYDPNRTAFIALVTYTDGEQAYILAPQRLAAGDKVIASDKAVDVKPGNTMPLQYIPVGSIIHNVEMKPGKGGQIARSAGTYVQLVGRDAGMAILRLNSGEQRLVHGSCLASIGAVSNSDHGNINDGKAGRSRWRGKRPHVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKFIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.431 kDa

MALKTFNPTTPSQRQLVIVDRSSLYKGKPVKSLTEGLSSKGGRNNTGRITVRFQGGGHKRTYRLVDFKRRKFDVEATVERIEYDPNRTAYIALVKYADGDQAYILAPQRLAAGDKVIASEKAVDVKPGNTMPLQFIPVGSIIHNVEMKPGKGGQIARSAGGYAQLVGRDQGMAILRLNSGEQRLVHGTCLATIGAVSNPDHGNINDGKAGRSRWRGKKPHVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKMIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.245 kDa

MALKNFNPTTPSQRQLVIVDRSGLYKGKPVKSLTEGLSSKGGRNNLGRITVRFQGGGHKRTYRLVDFKRRKFDVEGTVERLEYDPNRTAFIALITYADGEQAYILAPQRLAAGDKVIASDKAVDVKPGNAMPLQYVPVGSIVHNVELKPGKGGQVARSAGAYVQLVGRDAGMAILRLSSGEQRLVHGTCLATVGAVSNSDHGNINDGKAGRSRWRGKRPHVRGVVMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGKRTRSNKSTDKFIMRSRHQKKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.66 kDa

MSLKSFKPVTPSNRYKVWPSFDEITTSTPEKSLCRPLKKSGGRNNNGRITTRHIGGGHKRKYRLVDFKRNKFDVPATVLTIEYDPNRTCRIALIEYKDGEKSYILAPTGLQVGMKVESGQKVAPKVGNAMPLKNVPLGTSVHNIEIRPGSGGKVARAAGQQAIVSNREAGYALIKMPSGEIRRFNEDCYCTIGQVGNTQHMNEMSGKAGRTRWMGVRPTVRGMTMNPVDHPNGGGEGKSKSGGGRQHLKSPWGHVKGQKTRRLRKPSDSVIVQRRNAK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.874 kDa

MAIRKYKPTTPGRRASSVSEFEEITRSTPEKSLLRPLSKTGGRNNYGRITTRHIGGGHKRRYRLIDFRRTDKDGIPAKVAHIEYDPNRTANIALLHYADGEKRYIIAPKGLKQGTIVEAGPNADIKVGNNLPLRNIPTGTTIHAVELKPGAGAKLARSAGASIQLLGKEGKYAILRMPSSEIRRVDIRCRATVGEVGNADQMNIRWGKAGRMRWKGVRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGHKEGRTRNPNRYSNNMIVRRRRPNKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.945 kDa

MAIRKYKPTTPGRRASSVSEFSEITRSTPEKSLLRPLSKTGGRNVHGHITTRHKGGGHKRRYRVIDFRRNDKDGVVAKVAHIEYDPNRTANIALLHYRDGEKRYIIAPRGLKQGALVESGPNADIKVGNNLPLRNIPAGTTIHCVELKPGGGAKMARSAGASIQLLGKEGKYAVLRMPSSEIRRVDIRCRATVGEVGNQEQINIRWGKAGRMRWKGWRPTVRGAAMNPVDHPHGGGEGRTSGGRHPVSPWGQLEGRTRRPNRPSDKMIVRRRRPNKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.24 kDa

MALKTFKPVTPSLRQLVLVDRRELYKGKPVKALTEGKSSSGGRNNLGRITVRFRGGGHKRVLRNVDFKRRENLNVPATVERIEYDPNRTAFIALITFPDGKQSYILAPQRLSPGDKVIAGESVDVKPGNAAPIGSMPVGTIVHNVELKIGKGGAIARSAGNYAQIVGRDQGYVTLRLNSGEQRLVHGQCFATVGAVSNPDHMNISLGKAGRNRWLGKRPHVRGVAMNPVDHPHGGGEGRTSGGRNPVTPWGVPTKGKKTRSNKRTDTFILSSRHNRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.24 kDa

MALKTFKPVTPSLRQLVLVDRRELYKGKPVKALTEGKSSSGGRNNLGRITVRFRGGGHKRVLRNVDFKRRENLNVPATVERIEYDPNRTAFIALITFPDGKQSYILAPQRLSPGDKVIAGESVDVKPGNAAPIGSMPVGTIVHNVELKIGKGGAIARSAGNYAQIVGRDQGYVTLRLNSGEQRLVHGQCFATVGAVSNPDHMNISLGKAGRNRWLGKRPHVRGVAMNPVDHPHGGGEGRTSGGRNPVTPWGVPTKGKKTRSNKRTDTFILSSRHNRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.568 kDa

MALKNYNPTSPARRGLILVDKSGLYKGKPVKSLTEGKRKTGGRNNKGHVTSRGIGGGHKQKYRYIDFKRRKWDVEGTVERIEYDPNRTAFIALVKYDDGELAYIIAPQRLAVGDKVIAAEKADTKPGNAMLLGQMPVGTICHNVEMKPGKGGQIARSAGAYVQLVGRDRGMVIVRLNSGEQRYLRADCMGTVGAVSNPDNQNQNLGKAGRRRWMGVKPLTRGVAKNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRKNKQTDKFIIRSRHAKKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.279 kDa

MALKTFKPVTPSLRQLVIVDRSELYKGKPVKALTEGKISSGGRNNLGRVTVRFRGGGHKRTLRNVDFKRREHAGKVGTVERIEYDPNRTAFIALVTYEGGAQSYILAPQRVKAGDKVVSGDSVDIKPGNAMPIGNMPVGTIVHNVELKIGKGGAIARSAGNYAQIVGRDQGYVTLRLNSGEQRLVHGQCYATVGAVSNPDHMNISLGKAGRKRWLGRRPHNRGVAMNPIDHPHGGGEGRTSGGRHPVTPWGFPTKGKKTRSNKRTDTFIVSSRHNRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.213 kDa

MALKTFKPVTPSLRQLVLVDRRELYKGKPVKALTEGKSSSGGRNNLGRITVRFRGGGHKRVLRNVDFKRRENLNVPATVERIEYDPNRTAFIALITFPDGKQSYILAPQRLSPGDKVVAGESVDVKPGNAGPIGSMPVGTIVHNVELKIGKGGAIARSAGNYAQIVGRDQGYVTLRLNSGEQRLVHGQCFASVGAVSNPDHMNISLGKAGRNRWLGKRPHNRGVAMNPVDHPHGGGEGRTSGGRNPVTPWGVPTKGKKTRSNKRTDTFILSSRHNRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.182 kDa

MALKTFKPVTPSLRQLVLVDRRELYKGKPVKALTEGKSSSGGRNNLGRITVRFRGGGHKRVLRNVDFKRRDQLGVAATVERIEYDPNRTAFIALINFPDGKQSYILAPQRLQPGDKVVAGESVDIKPGNAGPVGSMPVGTIVHNVELKIGKGGAIARSAGNYAQIVGRDQGYVTLRLNSGEQRLVHGQCFASVGAVSNPDHMNISLGKAGRNRWLGKRPHNRGVAMNPVDHPHGGGEGRTSGGRNPVTPWGVPTKGKKTRSNKRTDVFILSSRHNRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.344 kDa

MALKTFKPVTPSLRQLVIVDRSELYKGKPVKALTEGKISSGGRNNLGRVTVRFRGGGHKRTLRNVDFKRREFAGKVGTVERIEYDPNRTAFIALVSYEGGGQSYILAPQRVKAGDRVVSGEQVDIKPGNAMPIGNMPVGTIVHNVELKIGKGGALARSAGNYAQIVGRDQGYVTLRLNSGEQRLVHGQCYATVGAVSNPDHMNISLGKAGRKRWLGRRPHNRGVAMNPIDHPHGGGEGRTSGGRHPVTPWGFPTKGKKTRSNKRTDTFIVSSRHNRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.644 kDa

MALKTFNPTTPGQRQLVMVDRSALYKGKPVKRLTEGKNSNGGRNNTGRITVRFRGGGHKQAYRLVDFKRTKVDVPAKVERLEYDPNRTAFIALIKYEDGEQAYILAPQRLAVGDTVIAGAYVDVKPGNVMPLGNMPIGTIVHNVELKIGKGGQLARSAGTYAQIVGRDHDYVILRMNSGEQRLIHGRCIAAIGAVSNPDHMNISIGKAGRKRWLGRRPHNRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTDKFILISRHKRKKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.619 kDa

MALKKYNPTTPGQRQLVLVDRSALYKGKPVKSLTEGKISNGGRNNTGRITVRFRGGGHKQTYRIVDFKRTKVDVPAKVERLEYDPNRTAFIALIKYEDGEQAYILAPQRLSVGDSVIAGSYVDVKPGNVMPLGNMPVGTIVHNIELKIGKGGQIARSAGTYAQLVGRDHDYVIVRLNSGEQRLVHGRCTATIGAVSNPDHMNISIGKAGRKRWLGRRPHNRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTDKFILISRHKRKKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.644 kDa

MALKTFNPTTPGQRQLVMVDRSALYKGKPVKRLTEGKNSNGGRNNTGRITVRFRGGGHKQAYRLVDFKRTKVDVPAKVERLEYDPNRTAFIALIKYEDGEQAYILAPQRLAVGDTVIAGAYVDVKPGNVMPLGNMPIGTIVHNVELKIGKGGQLARSAGTYAQIVGRDHDYVILRMNSGEQRLIHGRCIAAIGAVSNPDHMNISIGKAGRKRWLGRRPHNRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTDKFILISRHKRKKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.247 kDa

MGIRKYKPTTPGRRGSSVSDFVELTRSTPEKSLLVAKPKTGGRNNTGRITTRHIGGGHKQAYRIIDFKRYDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRYIIAPDGVGQGTVVVSGPEADIKPGNNLPLRNIPVGTTVHAVELRPGGGAKMGRSAGASVQLVAREGKYATVRLPSGEMRMVDIRCRATIGEVGNAEQININWGKAGRNRWKGIRPTVRGVVMNPIDHPHGGGEGRTSGGRHPVSPWGKPEGRTRNKKKASSRLIVRRRKSGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.939 kDa

MGIRKLKPTTQSSRYYSVLDFKEITEVVPYKPLTANISYKAGRDNKGRIAVRRKGGRNKRKFRIIDFKRNKFGIPATVKTIEYDPNRSAFIALVCYADGEYRYILAPNGLKVGDKIESGPAAEIKLGNTLPLDKIPAGTNVHNIELHIGKGGQIARTAGSFAVISAKDGDYVSLKLPSSEIRKVRKECLATIGELSNKDHNLVIIGKAGRNRWLGKRPKVRGVVMNPVDHPLGGGEGRTSGGRHPVTPWGKPTKGFKTRKTRPSDRFIVQRRKKNRNR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.546 kDa

MALKTFKPTSPGRRALVLVDRSALHKGRPEKTLVEGLTKKGGRNNMGRITARRRGGGAKRLYRLVDFKRRKWDMPATVERLEYDPNRTAFIALIKYEDGEKAYILAPQRLSEGDTVIASAKCDVKPGNAMPLKAVPVGTILHNVEMKPEKGGQIARSAGAYVQLVGRDAGYAQIRLASGELRMVSDKCMATVGAVSNPDHLNINLGKAGRNRHLGKRPSVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGAKTRKNKSTDKFIIRSRHERKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.456 kDa

MAIKTYKPYTPSRRFMSVLDSKDITAKSSVKGLLTKLKATAGRNNNGRITSRHKERGAKKLYRIIDFKRNKYNIEGKVAAIEYDPYRNARIALVVYPDGDKRYILQPSGLKVGDSVIAAEGGLDIKVGFAMKLKNIPIGTVVHNIEMHPGAGGQLARSAGMSAQIMGRENKYTILRMPSSEMRYILSECMASVGVVGNEDFINVSIGKAGRNRHRGIRPQTRGSAMNPVDHPHGGGEGKTGTSGHPVSPWGTPAKGYKTRKKKASDKLIISRKKHKKG

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.453 kDa

MALKQFNPTSPGRRQLVLVDKSELHKGRPEKSLVEGLTKSGGRGGNGRISVRFRGGGAKRLYRVIDFKRRKFDVPATVERLEYDPNRSAFIALVKYEDGELAYILAPQRLKVGDQVIAAEKADVKPGNAMPLRGMPIGTIIHNVELKPLKGGQIARSAGTYAQLVGRDAGYAQIRLNSGELRMVQDGCMATVGAVSNPDHMNESLGKAGRSRHKGRRPHVRGVAMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGRKTRKNKATDKFIIRSRHARKAR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.183 kDa

MALKNYKPVTPGQRQLVIVDRSGLHKGKPVKGLTVGLTSKGGRNNYGRITARFQGGGHKRTYRLIDFKRRKFDVSGVIERLEYDPNRTGFIALVRYDDGELSYILAPQRLAAGDRVISSAQSVDVKPGNAMPLAAMPVGTIVHNVELKPGKGGQIARSAGSYAQLVGRDQGMAILRLNSGEQRLVSGTCMATVGAVSNPDHANVSLGKAGRKRWLGKRPHNRGVTMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGRKTRSNKATDKFIMRSRHQRKS

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.608 kDa

MGIRKYKPTTPGRRGSSVADFVEITRSEPEKSLVRPLSKTGGRNSSGRITTRHIGGGHKRAYRLIDFRRHDKDGVPAKVAHIEYDPNRTARIALLHYVDGEKRYIIAPAKLKQGDRIENGPEADIKPGNNLPLRNIPVGTVIHAIEIRPGGGAKIARSAGASVQLVAREGRFAQLRMPSGEIRNVDVRCRATIGEVGNAEQSNINWGKAGRMRWKGKRPTVRGVAMNPIDHPHGGGEGKTSGGRHPVSPWGQPEGRTRRPGKESDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.34 kDa

MAIKIYKPTTNGRRHMTSSDFAEITKTKPEKTLLESQSHTAGRNSYGRITVRHRGGGHKQKYRIIDFKRNKDNVKAVVNAIEYDPNRTANIALLHYTDGIKAYILAPKGLKVGDIVESGDSVDIKPGNALALKNIPTGTSIHNIELKPGKGGQLVRSAGASAQVLGFDGNYTLVRLQSGEVRKILSSCRATIGVVGNEQHSLIQLGKAGRKRWLGKRPQSRGSVMNPNDHPHGGGEGKAPVGRPQPMTPWGKKARGIKTRDVKKASEKLIIRHRKGSK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.337 kDa

MAIIKYKPTSNGRRNMSGSDFAEITKTKPEKTLLVSQSHTAGRNAHGHITVRHRGGGHKQFYRVIDFKRNKDGMAATVKAIEYDPNRTANIALLHYEDGVKSYILAPKGLKVGDKVYSGEDVDIKVGNSLQLKNIPAGTTIHNIELKPGKGAQLARSAGVSAQLLGKDNDKYVTVKLASGEVRLILAENRATIGAVGNEQHELISIGKAGRKRWLGFRPTVRGSVMNPNDHPHGGGEGKAPIGHPSPMSPWGKKTLGKKTRDHKAKSEKFIVRHRRAK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.27 kDa

MAIKVYKPTSNGRRNMTSSDFAEITKSKPEKTLLASKSKTAGRNSYGHITVRHRGGGHKQQYRIIDFKRTKDNVKAKIVAIEYDPNRSANIALLHYTDGTKAYILAPKGLTVGSWVESGVDADIKVGNALPLKNIPTGTEVHNIELKPGKGGQIARSAGTSAQVLGVDGKYTQVRLQSGEVREILSECRATIGAVGNEQHSLINIGKAGRSRWMGKRPQSRGSVMNPNDHPHGGGEGKAPVGRPQPMTPWGKKSRGIKTRDSKKASEKLIIRHRKGRK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.27 kDa

MAIKVYKPTSNGRRNMTSSDFAEITKSKPEKTLLASKSKTAGRNSYGHITVRHRGGGHKQQYRIIDFKRTKDNVKAKIVAIEYDPNRSANIALLHYTDGTKAYILAPKGLTVGSWVESGVDADIKVGNALPLKNIPTGTEVHNIELKPGKGGQIARSAGTSAQVLGVDGKYTQVRLQSGEVREILSECRATIGAVGNEQHSLINIGKAGRSRWMGKRPQSRGSVMNPNDHPHGGGEGKAPVGRPQPMTPWGKKSRGIKTRDSKKASEKLIIRHRKGRK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.388 kDa

MAIIKYKPTTNGRRNMTSSDFAEITKKKPEKTLLESQSHTAGRNSYGHITVRHRGGGHKQKYRIIDFKRNKDDVKAVVKAIEYDPNRTANIALLHYTDGIKAYILAPKDLKVGTVVESGPNADIKPGNALPLSAIPAGTEIHNIELKPGKGGQLVRSAGTVAQVLGNDGKYTLVRLQSGEVRKILSTCRATIGSVGNEQHSLIQLGKAGRKRWLGKRPQSRGSVMNPNDHPHGGGEGKAPVGRPQPMTPWGKKSRGIKTRNSKARSEKLIIRHRKGNK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.43 kDa

MGIRKYKPTTPGRRGSSVADFVEVTRSEPEKSLVRPLSKSGGRNSTGRITSRRRGGGHKRAYRVIDFRRHDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRYIVAPNRLKQGDRIENGPAADIKPGNNLPLRNIPTGTVIHAVELRPGGGAKIARSAGSSVQLVAKDGPYAQLRMPSGEIRNVDARCRATIGEVGNAEQSNINWGKAGRMRWKGKRPSVRGVAMNPVDHPHGGGEGKTSGGRHPVSPWGQPEGRTRRPGKPSDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.358 kDa

MGIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRITTRHKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTANIALLHYLDGEKRYIIAPQGLKQGDVIESGANADIKPGNNLPLRNIPAGTVIHAVELRPGGGAKLARSAGVSIQLLGKEGTYAALRMPSGEIRRVDVRCRATVGEVGNAEQSNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKPSDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.35 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRITTRHKGGGHKRAYRVIDFRRHDKDGVDAKVAHIEYDPNRTANIALLHYLDGEKRYIIAPYGLKQGAIVESGANADIKPGNNLPLRNIPAGTVIHAVELRPGGGAKLARSAGVSIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKPSDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.35 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRITTRHKGGGHKRAYRVIDFRRHDKDGVDAKVAHIEYDPNRTANIALLHYLDGEKRYIIAPYGLKQGAIVESGANADIKPGNNLPLRNIPAGTVIHAVELRPGGGAKLARSAGVSIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKPSDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.35 kDa

MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRITTRHKGGGHKRAYRVIDFRRHDKDGVDAKVAHIEYDPNRTANIALLHYLDGEKRYIIAPYGLKQGAIVESGANADIKPGNNLPLRNIPAGTVIHAVELRPGGGAKLARSAGVSIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKPSDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.4 kDa

MAIRKYKPTTPGRRGSSVSDFAEITRDHPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTANIALLHYLDGEKRYIIAPQGLKQGAIVESGANADIKPGNNLPLRNIPAGTLVHAVELRPGGGAKMARSAGASIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPKKASDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.413 kDa

MALKSFNPTTPSQRQLVIVDRAGLYKGKPVKTLTEGLSSKGGRNNLGRITVRFQGGGHKRTYRLVDFKRRKFDVEGTVERLEYDPNRTAFIALVNYADGEQAYILAPQRLAAGDKVIASDKAVDVKPGNTMPLQFIPVGSIIHNVEMKPGKGGQIARSAGTYAQLVGRDQGMAILRLNSGEQRLVHGSCLASIGAVSNPDHGNINDGKAGRSRWRGKRPHVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKFIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.397 kDa

MALKSFNPTTPSQRQLVIVSRAGLYKGKPVKTLTEGLSSKGGRNNLGRITVRFQGGGHKRTYRLVDFKRRKFDVEGTVERLEYDPNRTAFIALVNYADGEQAYILAPQRLAVGDKVIASEKAVDVKPGNAMPLQFIPVGSIIHNVEMKPGKGGQIARSAGTYAQLVGRDQGMAILRLNSGEQRLVHGSCLASIGAVSNPDHGNINDGKAGRSRWRGKRPHVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKFIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.424 kDa

MGIRKYKPTTPGRRGASVADFVEITREHPEKSLVRPLHSKGGRNVYGRITTRHQGGGHKRAYRLIDFKRADKDGVPAKVAHIEYDPNRTARIALLHYADGEKRYILAPARLAQGDVVESGPGADIKPGNNLPLRNIPVGTVVHAIELRPGGGAKIARSAGASVQLVAKEGMYAQLRMPSGEIRNVDIRCRATVGEVGNAEQSNISWGKAGRMRWKGKRPSVRGVAMNPIDHPLGGGEGKSSGGRHPVSPWGKPEGRTRRKHKPSDKLIVRRRKSNKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.297 kDa

MAIKIYKPTTNGRRHMTSSDFAEITKTKPEKTLLESQSHTAGRNSYGHITVRHRGGGHKQKYRIIDFKRNKDNTKAVVKAIEYDPNRTANIALLHYTDGIKAYILAPKGLKVGDIVESGDSVDIKPGNALALKNIPSGTSIHNIELKPGKGGQLVRSAGASAQVLGVDGDYTLVRLQSGEVRKILSSCRATIGVVGNEQHSLIKLGKAGRKRWLGKRPQSRGSVMNPNDHPHGGGEGKAPVGRPQPMTPWGKKARGIKTRDTKKASEKLIIRRRKGSK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.26 kDa

MAIIKYKPTTNGRRNMTSSDFAEITKKKPEKTLLESQSHTAGRNSYGHITVRHRGGGHKQKYRIIDFKRNKDDVKAVVKAIEYDPNRTANIALLHYTDGIKAYILAPKGLKVGAVVESGPDADIKPGNALPLSAIPAGTEIHNIELKPGKGGQLVRSAGTVAQVLGNDGKYTLVRLQSGEVRKILSTCRATIGSVGNEQHSLIQLGKAGRSRWLGKRPQSRGSVMNPNDHPHGGGEGKAPVGRPQPMTPWGKKSRGIKTRNSKARSEKLIIRHRKGNK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.337 kDa

MAIIKYKPTSNGRRNMSGSDFAEITKTKPEKTLLVSQSHTAGRNAHGHITVRHRGGGHKQFYRVIDFKRNKDGMAATVKAIEYDPNRTANIALLHYEDGVKSYILAPKGLKVGDKVYSGEDVDIKVGNSLQLKNIPAGTTIHNIELKPGKGAQLARSAGVSAQLLGKDNDKYVTVKLASGEVRLILAENRATIGAVGNEQHELISIGKAGRKRWLGFRPTVRGSVMNPNDHPHGGGEGKAPIGHPSPMSPWGKKTLGKKTRDHKAKSEKFIVRHRRAK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.939 kDa

MGIRKLKPTTQSSRYYSVLDFKEITEVVPYKPLTANISYKAGRDNKGRIAVRRKGGRNKRKFRIIDFKRNKFGIPATVKTIEYDPNRSAFIALVCYADGEYRYILAPNGLKVGDKIESGPAAEIKLGNTLPLDKIPAGTNVHNIELHIGKGGQIARTAGSFAVISAKDGDYVSLKLPSSEIRKVRKECLATIGELSNKDHNLVIIGKAGRNRWLGKRPKVRGVVMNPVDHPLGGGEGRTSGGRHPVTPWGKPTKGFKTRKTRPSDRFIVQRRKKNRNR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.335 kDa

MALKTFNPTTPSQRQLVIVDRSSLYKGKPVKALTEGLTKSGGRNNLGRITARFIGGGHKRSYRLVDFKRRKFDVEGTVERIEYDPNRTAFIALVSYADGEQAYIIAPQRLAAGDKVIASEKAVDVKPGNTMPLQYIPVGSIIHNVEMKPGKGGQIARSAGSYAQLVGRDQGMAILRLNSGEQRLVSGICLASIGAVSNPDHANINDGKAGRTVWRGKRPHNRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKMIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.365 kDa

MALKTFNPTTPSQRQLVIVDRSSLYKGKPVKALTEGLTKSGGRNNLGRITARFIGGGHKRSYRLVDFKRRKFDIEGTVERIEYDPNRTAFIALVTYSDGEQAYIIAPQRLAAGDKVIASEKAVDVKPGNTMPLQYIPVGSIIHNVEMKPGKGGQIARSAGSYAQLVGRDQGMAILRLNSGEQRLVSGVCLASIGAVSNPDHANINDGKAGRTVWRGKRPHNRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKMIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.364 kDa

MALKTFNPITPSQRQLVIVDRSALYKGKPVKALTEGLTKSGGRNNLGRITARFIGGGHKRTYRLIDFKRRKFDVEGTVERIEYDPNRTAFIALVNYADGEKAYILAPQRLAAGDKVIASEKAVDVKPGNTMPLQFIPVGSIIHNVEMKPGKGGQIARSAGGYAQLVGRDQGMAILRLNSGEQRLVHGSCLASIGAVSNPDHANINDGKAGRTVWRGKRPHNRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKMIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.364 kDa

MALKTFNPITPSQRQLVIVDRSALYKGKPVKALTEGLTKSGGRNNLGRITARFIGGGHKRTYRLIDFKRRKFDVEGTVERIEYDPNRTAFIALVNYADGEKAYILAPQRLAAGDKVIASEKAVDVKPGNTMPLQFIPVGSIIHNVEMKPGKGGQIARSAGGYAQLVGRDQGMAILRLNSGEQRLVHGSCLASIGAVSNPDHANINDGKAGRTVWRGKRPHNRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKMIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.397 kDa

MALKSFNPTTPSQRQLVIVSRAGLYKGKPVKTLTEGLSSKGGRNNLGRITVRFQGGGHKRTYRLVDFKRRKFDVEGTVERLEYDPNRTAFIALVNYADGEQAYILAPQRLAVGDKVIASEKAVDVKPGNAMPLQFIPVGSIIHNVEMKPGKGGQIARSAGTYAQLVGRDQGMAILRLNSGEQRLVHGSCLASIGAVSNPDHGNINDGKAGRSRWRGKRPHVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRSNKSTDKFIMRSRHQRKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.251 kDa

MAIRKYKPTTPGRRGSSVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRLIDFRRNDKDGIPAKVAHIEYDPNRTANIALLHYADGEKRYIIAPKGLVQGSPVESGAGADIKPGNNLPLRNIPTGTTIHGVELRPGGGAKMARSAGASIQLLGKEGSYATLRMPSGEIRRVDVRCRASVGEVGNAEQSNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKNKASDKMIVRRRRTGKNKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.275 kDa

MAIRKYKPTTPGRRGSSVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRLIDFRRNDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRYIIAPKGLAQGAPVESGAGADIKPGNNLPLRNIPTGTTIHAVELRPGGGAKMARSAGSSIQLLGKEGTYATLRMPSGEIRRVDVRCRASIGEVGNAEQSNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKNKASDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.351 kDa

MAIRKYKPTTPGRRGSSVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITTRHKGGGHKRAYRLIDFRRNDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRYIIAPKGLFQGAPVESGAGADIKPGNNLPLRNIPTGTTIHAVELRPGGGAKMARSAGSSIQLLGKEGTYATLRMPSGEIRRVDVRCRASIGEVGNAEQSNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKNKASDKLIVRRRRTGKNKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.692 kDa

MALKKYNPTTPGQRQLVMVDRSALYKGKPVKTLTEGKHSNGGRNNTGRITVRFRGGGHKKTYRLVDFKRTKVDVPAKVERLEYDPNRTAFIALIKYEDGEQAYILAPQRLAVGDTVIAGAYVDVKPGNVMPLGNMPIGTIVHNVELKIGKGGQIARSAGTYAQLVGRDHDYVIMRLNSGEQRLVHGRCTATIGAVSNPDHMNISIGKAGRTRWLGWRPHNRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTDKFILISRHKRKKK

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.251 kDa

MAIRKYKPTTPGRRGSSVADFSEITRSTPEKSLIRPLHGTGGRNAHGRITTRHKGGGHKRAYRLIDFRRHDKDGVNAKVAHIEYDPNRTARIALLHFLDGEKRYIIAPVGLSQGDVVESGANADIKPGNNLPLRNIPTGTTVHAVELRPGGGAKLARSAGSGIQLLGKEGAYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKASDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.375 kDa

MALKSYNPTSPGQRGLILVDKSALWKGKPVKALTEGKRKTGGRNNKGHVTSRGIAGGHKQKYRFIDFKRRKWDVPATVERLEYDPNRTAFIALVKYEDGELAYILAPQRLAVGDTIVAGKKTDVKPGNAMELAQMPVGTIVHNIEMKPGKGGQIARSAGTYAQVVGRDRGLVIVRLGSGEQRYIRGECMGTVGAVSNPDNQNTNLGKAGRNRWLGKRPLTRGVAKNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRHNKSTDKMIIRSRHAKKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.376 kDa

MALKHYNPTSPARRGLILVDKSGLHKGKPVKALTEGKRKSGGRNNQGHATARGIAGGHKQKYRIVDFKRRKWDQPATVERLEYDPNRSAFIALVKYEDGELAYILAPQRLAAGDVVLAAKKTDTKPGNAMEIGQAPVGTIVHNVEMKPGKGGQIARAAGTYVQIVGRDKGMVMVRLNSGEQRYIRSDCMCTVGAVSNPDNANQNLAKAGRNRWLGRRPLTRGVAKNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRHNKATDKFIIRSRHAKKKR

rplB

50S ribosomal protein L2

278 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.847 kDa

MPIKSFKPVTPSRRNMTSLDYSVLTTDRPEKSLIKTRKKHAGRNNQGVITTRHKGGGHKVKYRIIDFKRNKDNIIGKIATIEYDPNRNAFICLVNYVDGEKRYILAPKTIKVGMQIVSAEKTDIKVGNCMKLKNIPEGTVLHNLELRPGKGGQLARSAGSSVQFLGKDEDGKYVTIRLTSGEVRKVLGECRATVGEVGNEDYALVNWGKAGRNRWRGIRPTVRGSAMNPNDHPHGGGEGKAPVGRKAPMTPWGKKALGVKTRNKKKASTKLIVRRRTK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.53 kDa

MAIKSYKPYTPSRRYMTGLSSEDITAKPSVRSLLVKLPATGGRNNNGRITSRHKEAGAKKLYRIIDFKRRKFGIEGKVEAIEYDPNRNCRIALIAYKDGEKRYIIRPNGLNVGDVIASIDEGSLDIKPGNAMKLRFIPVGTIVHNVELKPGKGAQIARSAGGYAQLMGKEEKYVILRMPSGEMRQVLAECMASIGVVGNEDWANITIGKAGRNRYRGIRPQTRGSAMNPVDHPHGGGEGKKNSGRHPVTPWGKPTKGAKTRRKKASDKLIISRRKGK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.502 kDa

MAIKSYKPYTPSRRYMTGLSSEDITAKPSVRSLLVKIPASGGRNNNGRITSRHKEAGAKKLYRIIDFKRKKFGIEGRVEAIEYDPNRNCRIALISYKDGEKRYIIRPNGLNVGDVIASIDEGALDIKPGNAMKLKFIPVGTIVHNIELKPGKGAQIARSAGGYAQLMGKEEKYVIVRMPSGEMRQILAECMASIGVVGNEDWANITIGKAGRNRYRGIRPQTRGSAMNPVDHPHGGGEGKKNSGRHPVTPWGKPTKGAKTRRKKASDKLIISRRKGK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.085 kDa

MAIVKMKPTSAGRRGMVRVVTEGLHKGAPYAPLLEKKNSTAGRNSNGHITTRHKGGGHKHHYRVVDFKRNKDGIPAKVERIEYDPNRTAFIALLCYADGERRYIIAPRGIQAGAVLVSGAEAAIKVGNTLPIRNIPVGTTIHCIEMKPGKGAQIARSAGASAVLLAKEAAYAQVRLRSGEVRKINVNCRATIGEVGNEEQSLKKIGKAGANRWRGIRPTVRGVVMNPVDHPHGGGEGRTGEAREPVSPWGTPAKGYRTRNNKRTDNMIVRRRYSNKG

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.098 kDa

MAIVKMKPTSAGRRGMVRVVTEGLHKGAPYAPLLEKKNSTAGRNNNGHITTRHKGGGHKHHYRVVDFKRNKDGIPAKVERIEYDPNRTAFIALLCYADGERRYIIAPRGIQAGAVLVSGAEAAIKVGNTLPIRNIPVGTTIHCIEMKPGKGAQIARSAGASAVLLAKEGAYAQVRLRSGEVRKINVNCRATIGEVGNEEQSLKKIGKAGANRWRGIRPTVRGVVMNPVDHPHGGGEGRTGEAREPVSPWGTPAKGYRTRNNKRTDNMIVRRRYSNKG

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.125 kDa

MAIVKMKPTSAGRRGMVRVVTEGLYKGAPYAPLLEKKNSTAGRNNNGHITTRHKGGGHKHHYRVVDFKRNKDGIPAKVERIEYDPNRTAFIALLCYADGERRYIIAPRGIQAGAVLVSGAEAAIKVGNTLPIRNIPVGTTIHCIEMKPGKGAQIARSAGASAVLLAKEGAYAQVRLRSGEVRKINVDCRATIGEVGNEEQSLKKIGKAGANRWRGIRPTVRGVVMNPVDHPHGGGEGRTGEAREPVSPWGTPAKGYRTRNNKRTDNMIVRRRYSNKG

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.098 kDa

MAIVKMKPTSAGRRGMVRVVTEGLHKGAPYAPLLEKKNSTAGRNNNGHITTRHKGGGHKHHYRVVDFKRNKDGIPAKVERIEYDPNRTAFIALLCYADGERRYIIAPRGIQAGAVLVSGAEAAIKVGNTLPIRNIPVGTTIHCIEMKPGKGAQIARSAGASAVLLAKEGAYAQVRLRSGEVRKINVNCRATIGEVGNEEQSLKKIGKAGANRWRGIRPTVRGVVMNPVDHPHGGGEGRTGEAREPVSPWGTPAKGYRTRNNKRTDNMIVRRRYSNKG

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.226 kDa

MTLKKSKPTSPGQRAVVRSVNSFLYKGNSYSALTEKKKKNSGRNNSGKITVRHIGGGHKHHYRIVDFCRNKDDIPAKVERIEYDPNRSAYLALLCYADGERKYIIAAKDIEVGSYVVNGSGSPVKTGNALPIRNIPVGSVIHCIELKPGKGAQLARSAGSSAQLMAREGDYSQIRLRSGEIRKIHINCRATIGEVGNSEHNLQSIGKAGAVRWRGIRPTVRGVAMNPVDHPHGGGEGKTAAGRHPVSPWGTPSKGSRTRRNKRTVNMIVRSRYSKKG

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.436 kDa

MALKTFNPTTPGQRQLVMVDRSALYKGKPVKALTEGKRGKGGRNNTGRITVRFRGGGHKQAYRNVDFKRGKEDVPAIVERLEYDPNRTAFIALIKYQDGEQAYILAPQRLAVGDTVVAGNYVDVKPGNVMPLGNMPVGTIVHNVEMKIGKGGQLARSAGTYAQIVGRDHDYVILRLNSGEQRLVHGRCRGAIGAVSNPDHMNTSIGKAGRTRWMGRRPHNRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTNKFILISRHKRKK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.227 kDa

MALVKVKPTSPGRRAVVKVVNAGLHKGAPYPHLVEKQNRTAGRNNKGQITTRHIGGGHKQHYRIVDFRRNKDGIAARVERLEYDPNRSANLALLCYSDGERRYVIAPKGIVPGMQLMSGADAPIKNGNALPLRNIPVGSIIHCVEMMPGKGAQLARSAGASVQLLAREGDYAQLRLRSGEIRRVHVNCRATIGEVGNEEHNLRAIGKAGAQRWRGIRPTVRGVAMNPIDHPHGGGEGKTAAGRHPVSPWGTPSKGFRTRVNKRTDGMIVRRRYSNKG

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.435 kDa

MALKTYNPTTPGQRQLVMVDRSALYKGKPVKTLTEGKRGKGGRNNTGRITVRFRGGGHKQAYRNVDFKRGKTDVPAVVERLEYDPNRTAFIALIKYQDGEQAYILAPQRMAVGDTVVAGNYVDVKPGNVMPLGNMPVGTIVHNVEMKIGKGGQLARSAGTYAQIVGRDQDYVILRLNSGEQRLVHGRCRGAIGAVSNPDHMNTSVGKAGRTRWMGRRPHNRGVVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTNKFILISRHKRKK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.134 kDa

MALKHFNPITPGQRQLVIVDRSGLYKGKPVKSLTEGLSKKGGRNNTGRITVRFQGGGHKRTYRFIDFKRRKLDVVGTVERLEYDPNRTAFIALIRYEDGELAYILAPQRLAVGDKVVAGNSVDVKPGNAMPLASMPVGTIVHNVELKPGKGGQIARSAGTYAQLVGRDQGMAILRLNSGEQRLVPGACFASVGAVSNPDHGNINDGKAGRSVWRGKRPHVRGVAMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGKKTRSNKSTDKFIMRSRHQRKK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.302 kDa

MAIKKYKPTSNGRRGMTSSDFAEITTDQPEKSLLAPLHKKGGRNNQGKLTVRHQGGGHKRQYRIIDFKRDKDGIPGRVATVEYDPNRSANIALINYVDGEKRYILAPKGLQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRATIGQVGNEQHELINIGKAGRSRWKGVRPTVRGSVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.271 kDa

MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHRKGGRNNQGRLTVRHQGGGHKRQYRIIDFKRDKDGIPGRVATIEYDPNRSANIALVNYADGEKRYILAPKGIQVGTEVTSGPEADIKPGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRATIGQVGNEQHELINIGKAGRSRWKGVRPTVRGSVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKTNKSDKFIVRRRKNK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.274 kDa

MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYILAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.358 kDa

MALKKYKPITNGRRNMTSLDFAEITKTTPEKSLLQPLPKRAGRNNQGKLTVRHHGGGHKRQYRVIDFKRNKDGINAKVDSIQYDPNRSANIALLVYADGEKRYIIAPKNLKVGQVLESGEEADIKVGNALPLQFIPVGTVIHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNIQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRPSPMSPWGKPTLGKKTRRGKKSSDKLIVRGRKKK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.013 kDa

MGIKVYKPTTNGRRNMTSLDFAEITTNTPEKSLLVSLKNKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYILAPKGLEVGQRIISGPEADIKVGNALPLANIPVGTVIHNIELQPGKGAELIRAAGASAQVLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRNRWKGVRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNQK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.013 kDa

MGIKVYKPTTNGRRNMTSLDFAEITTNTPEKSLLVSLKNKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYILAPKGLEVGQRIISGPEADIKVGNALPLANIPVGTVIHNIELQPGKGAELIRAAGASAQVLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRNRWKGVRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNQK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.013 kDa

MGIKVYKPTTNGRRNMTSLDFAEITTNTPEKSLLVSLKNKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYILAPKGLEVGQRIISGPEADIKVGNALPLANIPVGTVIHNIELQPGKGAELIRAAGASAQVLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRNRWKGVRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNQK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.917 kDa

MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKNKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPDADIKVGNALPLVNIPVGTVVHNIELKPGKGGELVRAAGASAQVLGQEGKYVLVRLQSGEVRMILGTCRATVGTVGNEQQSLVNIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSNKLLVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.902 kDa

MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKNKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPDADIKIGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQVLGQEGKYVLVRLQSGEVRMILGTCRATVGTVGNEQQSLVNIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSNKLIVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.925 kDa

MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDAVEAVVKTIEYDPNRSANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLVHNIELKPGRGGELVRAAGASAQVLGQEGKYTLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.876 kDa

MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQVLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.92 kDa

MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNNNGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQVLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.876 kDa

MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQVLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.92 kDa

MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNNNGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQVLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.876 kDa

MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNNNGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQVLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.92 kDa

MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNNNGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYIIAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQVLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.736 kDa

MSLKVLNPVTPSLRGTVMVNRVALWRGKPEKSLVVGRVSSGGRNAHGVITVRHRGGGHKRLHRVVDLKRNKDGVQAVVQRLEYDPNRTAFLALVRYEDGELSYILAPDGLKVSDVVVSGVGSDVLPGNCLQLGSIPAGTFVHNVELRPCGGGIIARAAGSYAQVMGRDGAYVLLRLGSGEVRKILALCRATVGVVSNLNNQNIKLGKAGRNRWLGFRPTVRGVAMNPVDHPHGGGEGKTSGGRNSVTPWGVPTKGKKTRKRGKHSDKYIKVSSVRKR

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

29.736 kDa

MSLKVLNPVTPSLRGTVMVNRVALWRGKPEKSLVVGRVSSGGRNAHGVITVRHRGGGHKRLHRVVDLKRNKDGVQAVVQRLEYDPNRTAFLALVRYEDGELSYILAPDGLKVSDVVVSGVGSDVLPGNCLQLGSIPAGTFVHNVELRPCGGGIIARAAGSYAQVMGRDGAYVLLRLGSGEVRKILALCRATVGVVSNLNNQNIKLGKAGRNRWLGFRPTVRGVAMNPVDHPHGGGEGKTSGGRNSVTPWGVPTKGKKTRKRGKHSDKYIKVSSVRKR

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.345 kDa

MAVKGFRPTTPTRREMTMCTFEEITTSTPEKSLLVSLKKSGGRNANGKITVRHIGGGAKRKYRIIDFKRNKDNIPAKVVSIEYDPNRTAFIALVVYADGEKRYIIAPVGLKVGDTVVSGPESDIKVGNCLPIRNIPVGTVIHNIELAAGKGAQLVRSAGNSAQLMAKEGDYSQVRLPSGEVRYIRVECRATIGVVSNQTSEIVNIGKAGRKRHMGVRPTVRGSVMNPNDHPHGGGEGRSPIGHPSPRTPWGKPALGYKTRKNKKYSDRFIVKRRHDK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.592 kDa

MAVKKYSPITPARRFMTSQDYSQLSKVEPEKSLLQSKSKNGGRNSYGRITVRHHGGGNRQKYRVIDFKRDKDGIKAKVATIEYDPNRTANIALLNYADGEKRYILAPVGLKVGDFVESGESSDIRTGNALPLANIPVGSMIHNIELKPGKGGQMVRAAGNAAQLMAKEGEYAQIRLPSGEVRMVRINCRATLGQIGNIEHENVKIGKAGRKRWMGVRPTVRGVVMNPVDHPHGGGEGKSPIGRPSPVTPWGKPTLGYKTRKKKKKSDKYIVKRRNQK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.091 kDa

MAVKGFKPTTPSRRHMTVNTFEEITTDIPEKSLLVALKRSGGRNAHGKITVRHIGGGAKRKYRIIDFKRNKDGIPAKVSTIEYDPNRSAFIALVTYADGEKRYIIAPVGLKVGDVIVSGADSDIKVGNCLPIVNIPVGTTIHNIELQAGKGAQLVRSAGTSAQLMAKEGKYATLRLPSGEVRYVRIECRATIGTVSNLTHEIINIGKAGRKRHMGIRPTVRGSVMNPNDHPHGGGEGKSPVGHPGPLTPWGKPALGLKTRKNKKYSDKFIIKRKNKK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.091 kDa

MAVKGFKPTTPSRRHMTVNTFEEITTDIPEKSLLVALKRSGGRNAHGKITVRHIGGGAKRKYRIIDFKRNKDGIPAKVSTIEYDPNRSAFIALVTYADGEKRYIIAPVGLKVGDVIVSGADSDIKVGNCLPIVNIPVGTTIHNIELQAGKGAQLVRSAGTSAQLMAKEGKYATLRLPSGEVRYVRIECRATIGTVSNLTHEIINIGKAGRKRHMGIRPTVRGSVMNPNDHPHGGGEGKSPVGHPGPLTPWGKPALGLKTRKNKKYSDKFIIKRKNKK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.124 kDa

MAVKKFRPITPSLRQMTVATFEEITTDKPEKSLLVSLNKKAGRNSQGKITVRHRGGGAKRKYRIIDFKRTKDGIPAKVASIEYDPNRTAYIALVVYADGEKRYIIAPVGLKVGDVVMSGVDADIKVGNALPLKNIPVGTVIHNVELQAGKGAQLVRAAGSSAQLMAKEGKYAILRLPSGEMRYVRIECRAAIGTVSNVTNDIINIGKAGRKRHLGFRPTVRGSVMNPNDHPHGGGEGKSPIGHPSPLTPWGKPALGYKTRKNKKYSDGMIIKRRGQK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.365 kDa

MALKKFNPTTPSRRQMTMPTFEEVTTNAPEKSLLVSLKKTGGRNAQGKITVRHHGGGAKRKYRIIDFKRNKDGIPAKVATVEYDPNRSAYIALVVYADGEKRYILAPVGLKVGDTVVSGPEADIKPGNALQLKHMPVGTFVHNIELQAGKGGQMVRSAGTSAQLMAKEGNYATLRLPSGEMRYVRIECKATVGTVSNTTHEIVNIGKAGRKRHMGWRPTVRGSVMNPCDHPHGGGEGRSPIGRPSPVTPWGKPALGYKTRKNKKYSDRFIIKRRNAK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.365 kDa

MALKKFNPTTPSRRQMTMPTFEEVTTNAPEKSLLVSLKKTGGRNAQGKITVRHHGGGAKRKYRIIDFKRNKDGIPAKVATVEYDPNRSAYIALVVYADGEKRYILAPVGLKVGDTVVSGPEADIKPGNALQLKHMPVGTFVHNIELQAGKGGQMVRSAGTSAQLMAKEGNYATLRLPSGEMRYVRIECKATVGTVSNTTHEIVNIGKAGRKRHMGWRPTVRGSVMNPCDHPHGGGEGRSPIGRPSPVTPWGKPALGYKTRKNKKYSDRFIIKRRNAK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.365 kDa

MALKKFNPTTPSRRQMTMPTFEEVTTNAPEKSLLVSLKKTGGRNAQGKITVRHHGGGAKRKYRIIDFKRNKDGIPAKVATVEYDPNRSAYIALVVYADGEKRYILAPVGLKVGDTVVSGPEADIKPGNALQLKHMPVGTFVHNIELQAGKGGQMVRSAGTSAQLMAKEGNYATLRLPSGEMRYVRIECKATVGTVSNTTHEIVNIGKAGRKRHMGWRPTVRGSVMNPCDHPHGGGEGRSPIGRPSPVTPWGKPALGYKTRKNKKYSDRFIIKRRNAK

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.175 kDa

MALIKVKPTSPGRRSVVKVVTPELHKGKPYAPLLEKQSKKAGRNNNGHITTRHQGGGHKQHYRIVDFRRNKDGIPAKVERLEYDPNRSAHLALLVYADGERRYIIAPRGVSVGAQLVSGSDAPIRAGNALPLRNIPVGSTIHCIELQPGKGAQVARSAGTSVQLLAREGSYAQLRLRSGEVRRVHVDCKATIGEVGNEEHSLRSIGKAGAVRWRGVRPTVRGVVMNPVDHPHGGGEGKTAAGMNPVSPWGLPTKGYRTRSNKRTDNMRVSRRPANKR

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

30.441 kDa

MGIRKHKPTTPGRRGSSVSDFAEITRSEPEKSLLRPLHGRGGRNAHGKITTRHKGGGHKRAYRLIDFRRNDKDGVPAKVAHIEYDPNRSARIALLHYADGEKRYIIAPNNVRQGDRIESGARADIKPGNNLPLRNIPTGTVVHAIELRPGGGAKIARSAGARVQLVAKDGPYAQLRMPSGEIRNVDARCRATVGEVGNSEHANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVNPKGKPEGRTRRNKPSDKLIVRRRRTGKKR

rplB

50S ribosomal protein L2

277 amino acids

One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.