RPC31

DNA-directed RNA polymerase III subunit RPC7

251 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. C31 is involved in the formation of the initiation complex.

Belongs to the eukaryotic RPC7 RNA polymerase subunit family.

27.724 kDa

MSSYRGGSRGGGSNYMSNLPFGLGYGDVGKNHITEFPSIPLPINGPITNKERSLAVKYINFGKTVKDGPFYTGSMSLIIDQQENSKSGKRKPNIILDEDDTNDGIERYSDKYLKKRKIGISIDDHPYNLNLFPNELYNVMGINKKKLLAISKFNNADDVFTGTGLQDENIGLSMLAKLKELAEDVDDASTGDGAAKGSKTGEGEDDDLADDDFEEDEDEEDDDDYNAEKYFNNGDDDDYGDEEDPNEEAAF

rpc31

DNA-directed RNA polymerase III subunit rpc31

210 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.

Belongs to the eukaryotic RPC7 RNA polymerase subunit family.

24.342 kDa

MRRGARGSTNLGGMTWQEVLEFNANSTPTKLYPDRDIPLQRSIRPEELLELRFYKEIRTSFLDESAFYIRRNPISVVQRNEDGLVRYSDRNKPKRKNDNLSLSDLDLDPKFFPEELRKTLGAASATGRKRARRKLDMKTFIDFTIKAQDLKDESSEAAHPNIEEEPDEGLEEEDEDFGDDDDNDYGENYFDNGEGDDYDDYDGDEGAIYE