RPB5

DNA-directed RNA polymerases I, II, and III subunit RPABC1

215 amino acids

DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. RNA polymerase complexes are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process.

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

25.079 kDa

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

RPB5

DNA-directed RNA polymerases I, II, and III subunit RPABC1

215 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

24.978 kDa

MDQDNERNVSRLWRAFRTVKEMVRDRGYFITQEEVDLSLEDFKAKYCDSMGRPQRKMMSFQSNPTEETLKKSPNMGSVWVEFCDEPSVGIKTMKNFVIHIGEKNFQTGIFIYQNGITPSALKLLPSVAPATIETFNETALVVNITHHELVPKHIKLSDEEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVVKIIRKSETSGRYASYRICL

RPB5

DNA-directed RNA polymerases I, II, and III subunit RPABC1

215 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

25.137 kDa

MDQENDRSISRLWRTFRTVKEMVRDRGYFIAQEELDLTLEDFKVKYCDSMGRAQRKMMSFQANPTEESMTKFPDMGTLWVEFCDEPSVGVKTMKTFVIHIQEKQFQTGIFIYQNNITPSAMKLVPSIPPATIETFHEAALVVNITHHDLVPKHIRLNEEEKAELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETAGRYASYRICM

RPB5

DNA-directed RNA polymerases I, II, and III subunit RPABC1

215 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

24.969 kDa

MDQEQERNISRLWRAFKTVKEMVRDRGYFITQEEIDLSLEDFKAKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSEAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL

RPB5

DNA-directed RNA polymerases I, II, and III subunit RPABC1

215 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

24.954 kDa

MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL

RPB5

DNA-directed RNA polymerases I, II, and III subunit RPABC1

214 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

24.902 kDa

MEDTDRTISRLWRSFKTVKEMVRDRGYYITQEEIDMSLAEFRSRICDSMNVPQRKLMCFQANPTAESLEKFPDLGSLWVEFCDEASVGIKTMRNFCIHISEKNFSTGIFIYQSSITPSANKLIPTVSPASIETFQEGDLVVNITHHDLVPKHIKLARDEKKELLERYRLKESQLPRIQREDPVGRYLGLKRGEVVKIIRRSETSGRYASYRICL

RPB5

DNA-directed RNA polymerases I, II, and III subunit RPABC1

212 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

24.403 kDa

MSSDDAQKLWKVYRTAKELVKDRGYTITDKEVNLSFDQFVSEMCDPMGKPIKKKMCFMASPSPEAIEKFPEMGNIWVEFCEEASVTVKTMRNFCIHISENKFATGILVYENNMTPSANRLIPSVAPATIDTFQETDLLVNITKHVLVPTHIKLSGAEKKFLLERYRLKESQLPRIQREDPVARYLGLRRGQIVKIIRRSETSGRYASYRICL

rpb5

DNA-directed RNA polymerases I, II, and III subunit RPABC1

210 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

23.915 kDa

MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRNLDRTTLSFYAKPSNDSNKGTIYIEFAKEPSVGIKEMRTFVHTLGDHNHKTGILIYANSMTPSAAKIIATVTGQFTIETFQESDLIVNITHHELVPKHILLSPDEKKELLDRYKLRETQLPRIQLADPVARYLGLKRGEVVKIVRRSETSGRYNSYRICA