ribR

RNA-binding riboflavin kinase RibR

230 amino acids

May be directly involved in the regulation of the rib genes. C-terminal part of RibR specifically binds to RFN of the rib leader of the riboflavin biosynthetic operon. The RFN element is a sequence within the rib-leader mRNA reported to serve as a receptor for an FMN-dependent riboswitch. Possibly, RibR produces the comodulator FMN through its own N-terminal flavokinase activity. FMN-activated RibR may stabilize the anti-anti terminator structure of RFN mRNA, causing transcription termination of the rib genes in trans.

Belongs to the RibR family.

26.229 kDa

MTIIAGTVVKGKQLGRKLGFPTANVDAKIHGLRNGVYGVLATVNHQFHLGVMNIGVKPTVGSNLEKTLEIFLFDFHRDIYGEKIECSILFKIREERRFDSLESLTKQIKKDISCVAKRFELIGIMAPNKKESLLSHQELNLPDLCFYKKCNNLYGVNRGVYNVIDNWFFEYGITQVAYRRIYILSFLSFLKEDNPKVSSKYIRFGAGGLADKLNRFISSYVEESEENILG