Function
Involved in depolymerization of xylan, a major component of the lignocellulosic substrates. Acts as an exo-oligoxylanase that efficiently hydrolyzes xylooligosaccharides, releasing xylose from their reducing ends. Hydrolyzes xylooligomers of 3 to 6 xylose units to xylose and xylobiose. Besides linear xylooligosaccharides, also hydrolyzes branched xylooligomers, such as xylooligomers decorated with 4-O-methyl-D-glucuronic acid moieties. Its proposed role is the degradation of xylooligomers produced by the activity of extracellular xylanases once they have been transported inside cells. Shows minor activity on polymeric xylan (glucuronoxylan from beechwood). Is not active on cellooligosaccharides or cellulosic substrates, or on other polysaccharides such as pectin, polygalacturonic acid, laminarin, or lichenan.
Sequence
MNITGKGAYDTGTYANLFQRSGYREDEIKARLEQTWNDLFYGDEHTRIYYPVGDDKGYMLDTGNDDVRSEGMSYGMMMAVQMDKKHEFDRLWNYAYTYMQHTEGRYKDYFAWHCKPDGTRLSPGPAPDGEEFFAMALFFASNRWGDGPAPYDYQAQARKILHACLHQGEQGEGDPMWEPSNRLIKFIPELPFSDPSYHLPHFYELFAQYANEQDRTFWKEAAEASRAYLRTACHPVTGLSPEYANYDGTPAPVQLHGDFRHFYSDAYRVAANVALDWEWFRKDPWQVQQSNRIQAFFSDIDVSDYRRYTIEGEPFNEPALHPVGLLATNAMASLAADGPDADSFVKRFWNTPLRQGKRRYYDNCLYFFTMLALSGNYRVY