relE

Toxin RelE

97 amino acids

In combination with RelB represses its own promoter. Has been seen to bind DNA in complex with cognate antitoxin RelB but not alone.

Belongs to the RelE toxin family.

11.064 kDa

MSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEIIHIARRSASYRMNPCRPR

relE

mRNA interferase toxin RelE

95 amino acids

Cross-talk can occur between different TA systems. Ectopic expression of this toxin induces transcription of 7 tested TA systems (dinJ/yafQ, hicAB, mazEF, mqsRA, prlF(sohA)/yhaV, relBEF and yefM/yoeB) with specific cleavage of the relBEF mRNA produced immediately upstream and within the relB coding sequence. The cleaved mRNA can be translated into RelE, leading to a positive feedback cycle of RelE expression. The relBEF operon is required for transcription of the mazEF TA system operon during amino acid starvation.

Belongs to the RelE toxin family.

11.225 kDa

MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL

relE

mRNA interferase RelE

95 amino acids

Toxic component of a type II toxin-antitoxin (TA) system. A sequence-specific, ribosome-dependent mRNA endoribonuclease that inhibits translation during amino acid starvation (the stringent response). Acts by cleaving mRNA with high codon specificity in the ribosomal A site between positions 2 and 3. Acts with RelB as a corepressor of relBE transcription (By similarity).

Belongs to the RelE toxin family.

11.225 kDa

MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL