recD

RecBCD enzyme subunit RecD

640 amino acids

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a highly rapid and processive ATP-dependent bidirectional helicase activity. Unwinds dsDNA until it encounters a Chi (crossover hotspot instigator) sequence from the 3' direction. Cuts ssDNA a few nucleotides 3' to the Chi site. The properties and activities of the enzyme are changed at Chi. The Chi-altered holoenzyme produces a long 3'-ssDNA overhang and facilitates RecA-binding to the ssDNA for homologous DNA recombination and repair. Holoenzyme degrades any linearized DNA that is unable to undergo homologous recombination. In the holoenzyme this subunit has ssDNA-dependent ATPase and 5'-3' helicase activity. When added to pre-assembled RecBC greatly stimulates nuclease activity and augments holoenzyme processivity. Negatively regulates the RecA-loading ability of RecBCD.

Belongs to the RecD family.

72.864 kDa

MLSVLHKLKELRILSQGDYYFAKLIADKQCHTDYAEPVKNLAILLAALCSWRYTQGNTCSQLDRYLEHNLFGLAYRTTEEDYLAEIHEKIGYLPVEDWQNALCGHMAFTQDPVNQIAPMAFQFGALYFYRAWQDEYRIVQYIKNTLKKYRTLAFSYDEIHQKLEKYFPEKQEKTDWQKVAVATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKNALGFMQEKMNVSHSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMIDLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVTQPYSHEQAAYLLATTGYKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLSEFIQKGKADDSLELFDHYPQELHFNSLNDEGDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQVQFNSVRFLTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGLCLANGKVWFGNREVLTNRIPAHEPAFMMTIHKSQGSEFKHTVMVLPTEVNPVLSRELVFTGVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN

recD

RecBCD enzyme subunit RecD

618 amino acids

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a highly rapid and processive ATP-dependent bidirectional helicase activity. Unwinds dsDNA until it encounters a Chi (crossover hotspot instigator) sequence from the 3' direction. Cuts ssDNA a few nucleotides 3' to the Chi site. The properties and activities of the enzyme are changed at Chi. The Chi-altered holoenzyme produces a long 3'-ssDNA overhang and facilitates RecA-binding to the ssDNA for homologous DNA recombination and repair. Holoenzyme degrades any linearized DNA that is unable to undergo homologous recombination. In the holoenzyme this subunit has ssDNA-dependent ATPase and 5'-3' helicase activity. When added to pre-assembled RecBC greatly stimulates nuclease activity and augments holoenzyme processivity. Negatively regulates the RecA-loading ability of RecBCD.

Belongs to the RecD family.

71.577 kDa

MTITSILQKMVKLKIITSSNFYLSTMLFNKNTLATFLSICVNHFTNHGHVCLPHVLIQHQKIFFTNHIALITKLWEIAKINTCGWIEQLLNSNTISNGSKNTPFIFYKNNFYINKFWLAEQKILKFISQKQNFKLINKNKIQKILKNIFNTNIDDTQKLAIILSIINNITFIIGGPGTGKTTIILKILLVLIRLHKKKINIKLTALTGKAANRLSESIHENIKKLNLTEHEKNIFNQKTTTLHNLLDLKPNKSFNYSCCKNKLYNLNLLIIDEASMIDITIMDKLISSIPKTTKIIFLGDYNQLPSISGGNILKNICSYYQEGFSTTTNKFLKQLFPNRITIKTIKKHQFSNINDKIIMLKKSYRFKKKSDIFKISEMLTKNKINNIKTLYQNINNDVNFKQISSKTNYNNIIFEITNSYSKYWSALKQSLPFLKIINIFNNYKILCILKNGLFGITELNLAIEKEMKKIGWIKKVTIINGQTWYFGKPILILKNNEEMNLFNGECGLTLLDANKKLKVFFLPKNQEQIYSIPIHLVPEHQTNWTMTVHKSQGSEFSEVVLILPTIMTSILTKELIYTAVTRSKKKLTIYSDENIFIKSLKKNIIRYSGLSIHQKIKF

recD

RecBCD enzyme subunit RecD

608 amino acids

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a rapid (>1 kb/second) and highly processive (>30 kb) ATP-dependent bidirectional helicase. Unwinds dsDNA until it encounters a Chi (crossover hotspot instigator, 5'-GCTGGTGG-3') sequence from the 3' direction. Cuts ssDNA a few nucleotides 3' to Chi site, by nicking one strand or switching the strand degraded (depending on the reaction conditions). The properties and activities of the enzyme are changed at Chi. The Chi-altered holoenzyme produces a long 3'-ssDNA overhang which facilitates RecA-binding to the ssDNA for homologous DNA recombination and repair. In the holoenzyme this subunit contributes ssDNA-dependent ATPase and fast 5'-3' helicase activity. When added to pre-assembled RecBC greatly stimulates nuclease activity and augments holoenzyme processivity. Negatively regulates the RecA-loading ability of RecBCD.

Belongs to the RecD family.

66.902 kDa

MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLENNEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQLASVEAGAVLGDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSYRFGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQSGEDYIAMLEEALAGYGRYLDLLQARAEPDLIIQAFNEYQLLCALREGPFGVAGLNERIEQFMQQKRKIHRHPHSRWYEGRPVMIARNDSALGLFNGDIGIALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHKSQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGLAALFSSRE

recD

RecBCD enzyme subunit RecD

602 amino acids

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a highly rapid and processive ATP-dependent bidirectional helicase activity. Unwinds dsDNA until it encounters a Chi (crossover hotspot instigator) sequence from the 3' direction. Cuts ssDNA a few nucleotides 3' to the Chi site. The properties and activities of the enzyme are changed at Chi. The Chi-altered holoenzyme produces a long 3'-ssDNA overhang and facilitates RecA-binding to the ssDNA for homologous DNA recombination and repair. Holoenzyme degrades any linearized DNA that is unable to undergo homologous recombination. In the holoenzyme this subunit has ssDNA-dependent ATPase and 5'-3' helicase activity. When added to pre-assembled RecBC greatly stimulates nuclease activity and augments holoenzyme processivity. Negatively regulates the RecA-loading ability of RecBCD.

Belongs to the RecD family.

69.495 kDa

MLILLKKAVKLKIIRPIDFYFSQFIAQKNNIVMLVAACVSYESSRGYISLPIKYFEKHYFFSSSNEVFIKKILTLLEKKINWPVELLKHASIGNGGTSTPLVLHKKKIYLYKMWKSESNIFNYLYTKNKKNKINQKKCSKILENLFPQKNMSFQKIAVALTLINNITFIIGGPGTGKTTTILKIIIALIKSSKKSIKIQLSAPTGKATTHLNEILKNNIFDLYFSEKEKCSLPSTATTIHQLLGIQKISQKSFFNKSNCLDLDVLIIDEISMVDILMMEKILSSISKNTKLIFIGDHNQLGPIESGSILRKICYYANDGYSFKSMISIEKLTQYKLCKKINKKTTNFISDNICVLNKNYRFNKNSGIYTLSNAIFKKKTRIIESLFDNSIKNIFFYETNSSEQYKKMIKNICLNYEDFWEKIYKKATMKEIIESFQNYQVLCILHDGLFGVNIINKKLEENMYKKNIIKYFYIDGEEWYIGKPIMIINNNRALNVSNGNIGITNINKNGILQVSFLKENNTINNIPVKILRNYKTAWAITVHKSQGSEFMNTALILPNFNSHILNKDTLYTGITRSRKILSIFSDKKIFLNTIFKNTNKILF

recD

RecBCD enzyme subunit RecD

602 amino acids

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a highly rapid and processive ATP-dependent bidirectional helicase activity. Unwinds dsDNA until it encounters a Chi (crossover hotspot instigator) sequence from the 3' direction. Cuts ssDNA a few nucleotides 3' to the Chi site. The properties and activities of the enzyme are changed at Chi. The Chi-altered holoenzyme produces a long 3'-ssDNA overhang and facilitates RecA-binding to the ssDNA for homologous DNA recombination and repair. Holoenzyme degrades any linearized DNA that is unable to undergo homologous recombination. In the holoenzyme this subunit has ssDNA-dependent ATPase and 5'-3' helicase activity. When added to pre-assembled RecBC greatly stimulates nuclease activity and augments holoenzyme processivity. Negatively regulates the RecA-loading ability of RecBCD.

Belongs to the RecD family.

70.408 kDa

MNMSHLLQNFANKKIITLVDFYFSQFISKKNSIIMLISACVSFESKNGHIFLPIEYFEKNCFFSISNKQFINKILKCLNKKKINWSLELSEHISCGDGSIITPLVFYKDKIYLYKIWKAEKKILERLYEKNQFDTIDTQQCLNILNNLFSKKKHDLQKIAVILTLINNIIFITGGPGTGKTTIILKIIIALIKNAKKKIKIQLSAPTGKATENLIEILNDKWLNRYLLKEEKKQFSFNPIMTIHQLLGISKKSEKIFFNKNNLLMIDILIIDEASMIDILMMSNILSALSKKTKIIFIGDHNQLKPVKSSSILKYICSYAEDGYSLKTQSILQEITQNSIINYKINKKNTSYISDKICVLKKSYRFEKKTGIYILSNAVYNKETKIFEKLFKNSIENVFFYEINSEIEYKKMINIIINNNKIFWRKIYEKKNIKEIIKTFKNHQILCIVKNGFFGVNFINKILEEEMYKRNIFNKRFYINNKLWYIGKPIIITENNQCLGIFNGEIGITNLSQKNTLQVSFLKKDNFIENIPIEILKNYKTSWSITVHKAQGSEFNNISLILPNKNLKILKKDILYTGITRTRKQLNIFSTKEIFIKTVLKN

recD

RecBCD enzyme subunit RecD

575 amino acids

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a highly rapid and processive ATP-dependent bidirectional helicase activity. Unwinds dsDNA until it encounters a Chi (crossover hotspot instigator) sequence from the 3' direction. Cuts ssDNA a few nucleotides 3' to the Chi site. The properties and activities of the enzyme are changed at Chi. The Chi-altered holoenzyme produces a long 3'-ssDNA overhang and facilitates RecA-binding to the ssDNA for homologous DNA recombination and repair. Holoenzyme degrades any linearized DNA that is unable to undergo homologous recombination. In the holoenzyme this subunit has ssDNA-dependent ATPase and 5'-3' helicase activity. When added to pre-assembled RecBC greatly stimulates nuclease activity and augments holoenzyme processivity. Negatively regulates the RecA-loading ability of RecBCD.

Belongs to the RecD family.

61.747 kDa

MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRAGSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREEEQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTVARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVTLHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQLASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSGEERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKRKVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG

recD

RecBCD enzyme subunit RecD

575 amino acids

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a highly rapid and processive ATP-dependent bidirectional helicase activity. Unwinds dsDNA until it encounters a Chi (crossover hotspot instigator) sequence from the 3' direction. Cuts ssDNA a few nucleotides 3' to the Chi site. The properties and activities of the enzyme are changed at Chi. The Chi-altered holoenzyme produces a long 3'-ssDNA overhang and facilitates RecA-binding to the ssDNA for homologous DNA recombination and repair. Holoenzyme degrades any linearized DNA that is unable to undergo homologous recombination. In the holoenzyme this subunit has ssDNA-dependent ATPase and 5'-3' helicase activity. When added to pre-assembled RecBC greatly stimulates nuclease activity and augments holoenzyme processivity. Negatively regulates the RecA-loading ability of RecBCD.

Belongs to the RecD family.

61.747 kDa

MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRAGSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREEEQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTVARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVTLHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQLASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSGEERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKRKVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG

recD

RecBCD enzyme subunit RecD

554 amino acids

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a highly rapid and processive ATP-dependent bidirectional helicase activity. Holoenzyme degrades any linearized DNA that is unable to undergo homologous recombination. In the holoenzyme this subunit has ssDNA-dependent ATPase and 5'-3' helicase activity. When added to pre-assembled RecBC greatly stimulates nuclease activity and augments holoenzyme processivity (By similarity). Unlike the case in E.coli, suppresses RecA-dependent homologous recombination, is instead required for single-strand annealing pathway repair of DSB.

Belongs to the RecD family.

59.516 kDa

MSLLEAFAEILEPADVHVAQRLTVLADEPDASVELAVALAVRALRGGSVCVDLRSVAGQVELPDLPWPDPDAWLAALAASPLLGQPPVLRLFGDLLYLDRYWLEEQQVCDDVLALVSARPGGAVPDVSRLFGAGFEEQRAAAKVALSQGLTVLTGGPGTGKTTTVARLLALLAEQAALAGKPSPRIALAAPTGKAAARLQEAVQLEIDQLDLIERRRLTGLHATTLHRLLGPRPDTSSRFRHHRANRLPHDVIVVDETSMVSLTMMARLLEAVRPQTRLVLVGDPDQLASVEAGAVLADLVEGLGSRGVAELKTSHRFGESIGALASAIRTGDADAALAVLAAGGEHIEWVHEDPVEQLREVVVPHAMRLRQAAILGDQREALATLDEHRLLCAHRRGPAGVDHWNRQVQRWLGEETGEPLWGSWYVGRPILVTANDYGLKLYNGDTGVVVATPDGMRAVIGDAGTFATGRLTDVETMHAMTIHKSQGSQADEVTVLLPSEDSRLLTRELFYTAVTRAKTRVRVVGAEAEVRAAIERQAVRATGLRKRLRPAGV