About Products Protein Database Contact

rasp

Gene
rasp
Protein
Protein-cysteine N-palmitoyltransferase Rasp
Organism
Drosophila melanogaster
Length
500 amino acids
Function
Required in hedgehog (hh) expressing cells for production of appropriate signaling activity in embryos and in the imaginal precursors of adult tissues. Acts within the secretory pathway to catalyze N-terminal palmitoylation of Hh; this lipid modification is required for the embryonic and larval patterning activities of the Hh signal. Not required for Wg signaling.
Similarity
Belongs to the membrane-bound acyltransferase family. HHAT subfamily.
Mass
58.106 kDa
Sequence
MSRLPDRSLLTRCEIFVYFGVYIAYIVVGLYKIYGLRDHIVKEAKFQFPEGWSLYPFSQRRRDDSNDELENFGDFIVSFWPFYLLHVAVQGFIRWKRPRLQCLGFIGVCALALSVNLDWSSMVLLVTLIASYYIVSLLSLKFLVWLLSAGWILCINVMQKNVWWTDRVGYTEYVLVIVTMSWSVLRGCSYSLSKIGAKQEDLTRYSLVQYLGYAMYFPCLTYGPIISYQRFAARREDEVQNWLGFVGGVLRSAIWWLVMQCALHYFYIHYMSRDVRMVEMMDSVFWQHSAGYFMGQFFFLYYVVTYGLGIAFAVQDGIPAPNRPRCIGRIHFYSDMWKYFDEGLYEFLFQNIYAELCGKRSSAAAKFGATALTFAFVFVWHGCYTYVLIWSILNFLCLAAEKVFKTFTAMPEYQRWTQRHLGAVGAQRLYAMLATQLFIPAAFSNVYFIGGQEIGDFLMRGAYLSGVGNYVALCFCSYCFFQCSELLLTKSDGRSKTKTF

Gene
rasp
Protein
Protein-cysteine N-palmitoyltransferase Rasp
Organism
Drosophila melanogaster
Length
500 amino acids
Function
Required in hedgehog (hh) expressing cells for production of appropriate signaling activity in embryos and in the imaginal precursors of adult tissues. Acts within the secretory pathway to catalyze N-terminal palmitoylation of Hh; this lipid modification is required for the embryonic and larval patterning activities of the Hh signal. Not required for Wg signaling.
Similarity
Belongs to the membrane-bound acyltransferase family. HHAT subfamily.
Mass
58.106 kDa
Sequence
MSRLPDRSLLTRCEIFVYFGVYIAYIVVGLYKIYGLRDHIVKEAKFQFPEGWSLYPFSQRRRDDSNDELENFGDFIVSFWPFYLLHVAVQGFIRWKRPRLQCLGFIGVCALALSVNLDWSSMVLLVTLIASYYIVSLLSLKFLVWLLSAGWILCINVMQKNVWWTDRVGYTEYVLVIVTMSWSVLRGCSYSLSKIGAKQEDLTRYSLVQYLGYAMYFPCLTYGPIISYQRFAARREDEVQNWLGFVGGVLRSAIWWLVMQCALHYFYIHYMSRDVRMVEMMDSVFWQHSAGYFMGQFFFLYYVVTYGLGIAFAVQDGIPAPNRPRCIGRIHFYSDMWKYFDEGLYEFLFQNIYAELCGKRSSAAAKFGATALTFAFVFVWHGCYTYVLIWSILNFLCLAAEKVFKTFTAMPEYQRWTQRHLGAVGAQRLYAMLATQLFIPAAFSNVYFIGGQEIGDFLMRGAYLSGVGNYVALCFCSYCFFQCSELLLTKSDGRSKTKTF

Gene
rasP
Protein
Zinc metalloprotease RasP
Organism
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Length
424 amino acids
Function
Is responsible for Site-2 cleavage of the RsiW anti-sigma factor. This results, after a third proteolytic step catalyzed by the ClpXP protease, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Similarity
Belongs to the peptidase M50B family.
Mass
47.041 kDa
Sequence
MTTVVAFILMFGVLVSIHEWGHLIFAKRAGMLVREFAIGFGPKIFSFTKNETLYTIRLIPAGGYVRVAGEDPEIIELKPGHHIGLEFNQAGEVSKIIVNNKSKHPYARVIEVENVDLDHKLIIEGYELDDDENRLSFNVNEKAMFVMDERETQIAPYNRQFASKSTGKRAMQLFAGPMMNFVLAIAIFLILGIIQGVPVEEAKLGEIQPDTPAEQAGFQQDDVITQIGDQSISTWEEFTSIVRENPGQELDMVIQRNGESQDISVVPGEAEAVNEVGDPITIGQIGVYQGFEKDVLGTFVYGIERTYDTTTMIIQNLFMLVTGQVSIELLSGPVGIYDATDQVVQTGFSNFLLWTAMLSINLGIINLVPLPALDGGRLLFVGLEAVRGKPIAPEKEGIFHFVGFALLMLLMIVVTWNDIQRLFL

Gene
rasP
Protein
Regulator of sigma-W protease RasP
Organism
Bacillus subtilis (strain 168)
Length
422 amino acids
Function
Is responsible for site-2 cleavage of the RsiW anti-sigma factor (PubMed:15130127). This results, after a third proteolytic step catalyzed by the ClpXP protease, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (PubMed:16899079). Can also cleave liberated signal peptides of PenP and Mpr, probably within in the cell membrane (PubMed:21810987).
Similarity
Belongs to the peptidase M50B family.
Mass
46.744 kDa
Sequence
MFVNTVIAFIIIFGTLVFFHELGHLLLAQRAGILCREFAIGFGPKIFSFKKNETVYTIRLLPVGGFVRMAGEDPEMIEVKPGYTVGLLFNKEDQVEKVIINQKEKYPDALVIEVETADLEHDMKITGYEQGKEDELSSFTVSETSFFIVDGEEVQIAPYNRQFGSKPVWQRIKAIAAGPIMNFILAYVILVMLGLIQGVPSNEPMLGQLTDNGRAAEAGLKEGDYIQSINGEKMRSWTDIVSAVKENPEKEMDVAVKRDNKTLHISVTPEAVKDENKKTIGRFGSYAPTEKGVLSAVAYGATSTVDVTKAILTNLSKLVTGQFKLDMLSGPVGIYDMTDQVAKTGIVNLFQFAAFLSINLGIVNLLPIPALDGGRLLFLFIEAIRGKPINREKEAFVVFIGVAFLMLLMLVVTWNDIQRLFL

Gene
rasP
Protein
Zinc metalloprotease RasP
Organism
Geobacillus kaustophilus (strain HTA426)
Length
421 amino acids
Function
Is responsible for Site-2 cleavage of the RsiW anti-sigma factor. This results, after a third proteolytic step catalyzed by the ClpXP protease, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Similarity
Belongs to the peptidase M50B family.
Mass
46.681 kDa
Sequence
MVETLESIISFIVVFGALVFFHELGHLLLAKRAGILCREFAIGFGPKVFSFKKNETVYTIRLLPLGGFVRMAGEDPETIELKRGQVVGLLLDESGQVEKIVLNHKDDYPNIRVVEVEEADLEHGMYVTGYTDGERFERFTVKEPAFFVVDRQEIQIAPYHRQFAAKTLGQRTMTILAGPLANFLLSLVVFIIIGLLQGYPVDKPVIGELTPEGAARAAGLKQGDKVIAINGERMETWTEIVNTIRAHPGEPLQFQIERNGKERSVTVTPEAKTVQGETIGLIGVYQPMEKSVLGSIKQGLVETYYWTREIVTGLGQLITGQFQLDMLSGPVGIAVSTGKVAESGIYYLMKWGAILSINLGIVNLLPLPALDGGRLLFFAIEAVRGKPVDRQKEGMVHFIGFALLMLLMLVVTWNDIQKFFL

Gene
rasP
Protein
Zinc metalloprotease RasP
Organism
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Length
420 amino acids
Function
Is responsible for Site-2 cleavage of the RsiW anti-sigma factor. This results, after a third proteolytic step catalyzed by the ClpXP protease, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Similarity
Belongs to the peptidase M50B family.
Mass
46.476 kDa
Sequence
MQTLIAFLVMFGVLVSVHEWGHLYFAKRAGILCREFAIGFGPKLFSWKRNETVYTIRLIPLGGYVRMAGEDPELITIKPGYEVGLVFNEKNVVSRIIVNNKSKHPEAQVVQVERIDLERELFIEAYDDDGERKRWDVDPKAEMVQDEEATQIAPYDRQFGSKSVAQRALAIFAGPLMNFVLAFVLLAAYGFMQGIPVEDPVVGNIAENSAAETAGLQKGDYVLSIDGQTLETWVDMTMIIQQHPNEEITFEVERAGQILQIPVTPNQVEGMDGEPIGLVGIERPAPEPATLVSGLQFGATQTYTYMTMIFDVLRLLVTGQFSLDYVAGPVGIVNYTGQAAEMGIFVLLQWTAALSVNLGIVNLLPLPALDGGRLVFLGLEAVRGKPLDPSKESLVHFVGFALLMLLVLVVTWNDINRLFL

Gene
rasP
Protein
Zinc metalloprotease RasP
Organism
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Length
419 amino acids
Function
Is responsible for Site-2 cleavage of the RsiW anti-sigma factor. This results, after a third proteolytic step catalyzed by the ClpXP protease, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Similarity
Belongs to the peptidase M50B family.
Mass
46.45 kDa
Sequence
MNTVIAFILIFGTLVFFHELGHLILAQRAGILCREFAIGFGPKIFSFKKNETVYTIRLLPIGGFVRMAGEDPEMIEVKPGYTVGLLFDSENKVEKIIINQKEKYPDALVIEVEQADLEHQMRITGYEHGNEDHLSSFSVSETSFFIVDGEEVQIAPYNRQFHSKTVWQRIKAIAAGPIMNFILAYVILVMLGLMQGVPSDEPVLGKLIDNGRAAEAGLQEGDRIQTINGENMRSWTDIVNTVREHPEKELKIVLMRDNVKLTKYVTPEAVKAGDETVGRFGAYNPVKTGVLTSISYGATETATVAQSIVTNLGKLVTGQFSIDMLAGPVGIYDMTDQVAKTGVINLLKLAAFLSINLGIVNLLPIPALDGGRLLFLFIEAIRGKPINREKEAFVVFIGVAFLMLLMLVVTWNDIQRLFL

Gene
rasP
Protein
Zinc metalloprotease RasP
Organism
Bacillus clausii (strain KSM-K16)
Length
418 amino acids
Function
Is responsible for Site-2 cleavage of the RsiW anti-sigma factor. This results, after a third proteolytic step catalyzed by the ClpXP protease, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Similarity
Belongs to the peptidase M50B family.
Mass
46.057 kDa
Sequence
MNTLLAFIAIFSVLVFVHEWGHLYFAKKAGILCYEFAIGMGPKLFAFERNDTIYTIRLLPIGGYVRMAGEEPEQPTIRPGYEIGLVLDEKDTVKELIVNNKSKHPEAQVVQVERIDLVHDLFVETIDEDTGELVRYPIDEKAFIVQDEVAQIIAPWKRQFGSKPLPKRAMAIFAGPLMNFILGFVILLGLSLYQGVTLSSEIVINGENSPAEAAGLQDGDVITAVNGVEVDSWKEMTTEVKKYPGEEVSIDYERNGEALQTNATLSQVEVMPDEYEGFLGVSGVPEFSLLGSLQYAGNEFINMATSIFDTLGLIFTGQFSLDYISGPVGIYDITDQAVSLGIQTVIFFAALLSINLGVINLMPIPALDGGRLMFLAYEGIRGKPVSPEKEGAIQFIGFALVMLLMIVVTWNDISKLFS