qcrA

Cytochrome bc1 complex Rieske iron-sulfur subunit

429 amino acids

Iron-sulfur subunit of the cytochrome bc1 complex, an essential component of the respiratory electron transport chain required for ATP synthesis. The bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain. The bc1 complex operates through a Q-cycle mechanism that couples electron transfer to generation of the proton gradient that drives ATP synthesis.

46.923 kDa

MSRADDDAVGVPPTCGGRSDEEERRIVPGPNPQDGAKDGAKATAVPREPDEAALAAMSNQELLALGGKLDGVRIAYKEPRWPVEGTKAEKRAERSVAVWLLLGGVFGLALLLIFLFWPWEFKAADGESDFIYSLTTPLYGLTFGLSILSIAIGAVLYQKRFIPEEISIQERHDGASREIDRKTVVANLTDAFEGSTIRRRKLIGLSFGVGMGAFGLGTLVAFAGGLIKNPWKPVVPTAEGKKAVLWTSGWTPRYQGETIYLARATGTEDGPPFIKMRPEDMDAGGMETVFPWRESDGDGTTVESHHKLQEIAMGIRNPVMLIRIKPSDLGRVVKRKGQESFNFGEFFAFTKVCSHLGCPSSLYEQQSYRILCPCHQSQFDALHFAKPIFGPAARALAQLPITIDTDGYLVANGDFVEPVGPAFWERTTT

qcrA

Cytochrome bc1 complex Rieske iron-sulfur subunit

429 amino acids

Iron-sulfur subunit of the cytochrome bc1 complex, an essential component of the respiratory electron transport chain required for ATP synthesis. The bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain. The bc1 complex operates through a Q-cycle mechanism that couples electron transfer to generation of the proton gradient that drives ATP synthesis.

46.923 kDa

MSRADDDAVGVPPTCGGRSDEEERRIVPGPNPQDGAKDGAKATAVPREPDEAALAAMSNQELLALGGKLDGVRIAYKEPRWPVEGTKAEKRAERSVAVWLLLGGVFGLALLLIFLFWPWEFKAADGESDFIYSLTTPLYGLTFGLSILSIAIGAVLYQKRFIPEEISIQERHDGASREIDRKTVVANLTDAFEGSTIRRRKLIGLSFGVGMGAFGLGTLVAFAGGLIKNPWKPVVPTAEGKKAVLWTSGWTPRYQGETIYLARATGTEDGPPFIKMRPEDMDAGGMETVFPWRESDGDGTTVESHHKLQEIAMGIRNPVMLIRIKPSDLGRVVKRKGQESFNFGEFFAFTKVCSHLGCPSSLYEQQSYRILCPCHQSQFDALHFAKPIFGPAARALAQLPITIDTDGYLVANGDFVEPVGPAFWERTTT

qcrA

Cytochrome bc1 complex Rieske iron-sulfur subunit

429 amino acids

Iron-sulfur subunit of the cytochrome bc1 complex, an essential component of the respiratory electron transport chain required for ATP synthesis. The bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain. The bc1 complex operates through a Q-cycle mechanism that couples electron transfer to generation of the proton gradient that drives ATP synthesis.

46.905 kDa

MSRADDDAVGVPPTCGGRSDEEERRIVPGPNPQDGAKDGAKATAVPREPDEAALAAMSNQELLALGGKLDGVRIAYKEPRWPVEGTKAEKRAERSVAVWLLLGGVFGLALLLIFLFWPWEFKAADGESDFIYSLTTPLYGLTFGLSILSIAIGAVLYQKRFIPEEISIQERHDGASREIDRKTVVANLTDAFEGSTIRRRKLIGLSFGVGMGAFGLGTLVAFAGGLIKNPWKPVVPTAEGKKAVLWTSGWTPRYQGETIYLARATGTEDGPPFIKMRPEDIDAGGMETVFPWRESDGDGTTVESHHKLQEIAMGIRNPVMLIRIKPSDLGRVVKRKGQESFNFGEFFAFTKVCSHLGCPSSLYEQQSYRILCPCHQSQFDALHFAKPIFGPAARALAQLPITIDTDGYLVANGDFVEPVGPAFWERTTT

qcrA

Cytochrome bc1 complex Rieske iron-sulfur subunit

408 amino acids

Iron-sulfur subunit of the cytochrome bc1 complex, an essential component of the respiratory electron transport chain required for ATP synthesis. The bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain. The bc1 complex operates through a Q-cycle mechanism that couples electron transfer to generation of the proton gradient that drives ATP synthesis.

45.29 kDa

MSNNTNKQYTTQELNSMSNDDLARLGTELDDVTIAYRKERFPVANDPAEKRAARSVGIWAALGILGGIGFLITYIFWPWEYQGHGDDGLMWYTLYTPMLGITSGLCIISLGIAGVLYVKKFIPEEIAVQRRHDGPSEEVDRRTLVALLNDSWQTSTLGRRKVLQGLLAGGAVMAGLTIVAPLGGMIKNPWRPQDGPMDVMGDGTLWTSGWTLQEQGVKLYLGRDTGAIAESHTGESGQHWITTGVSRLVRMRPEDLAAASMETVFPLPAEDVNDGDLYDPQRDVYTNHMHSIHGPRNAVMLIRLRTADAERVIEREGQESFHYGDYYAYSKICTHIGCPTSLYEAQTNRILCPCHQSQFDALHYGKPVFGPAARALPQLPITVDEEGYLIADGNFIEPLGPAFWERKS

qcrA

Cytochrome bc1 complex Rieske iron-sulfur subunit

408 amino acids

Iron-sulfur subunit of the cytochrome bc1 complex, an essential component of the respiratory electron transport chain required for ATP synthesis. The bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain. The bc1 complex operates through a Q-cycle mechanism that couples electron transfer to generation of the proton gradient that drives ATP synthesis.

45.184 kDa

MSNNNDKQYTTQELNAMSNEDLARLGTELDDVTIAYRKERFPIANDPAEKRAARAVTFWLVLGIIGGLGFLATYIFWPWEYKAHGDEGLLAYTLYTPMLGITSGLCILSLGFAVVLYVKKFIPEEIAVQRRHDGPSEEVDRRTIVALLNDSWQTSTLGRRKLIMGLAGGGAVLAGLTIIAPMGGMIKNPWNPKEGPMDVQGDGTLWTSGWTLVENDVKVYLGRDTAAIAESHTDATGEHWSTTGVSRLVRMRPEDLAAASMETVFPLPAEMVNDGAEYDPAKDVYEHQMHSVHGPRNAVMLIRLRTADAEKVIEREGQESFHYGDYYAYSKICTHIGCPTSLYEAQTNRILCPCHQSQFDALHYGKPVFGPAARALPQLPITVDEEGYLIAAGNFIEPLGPAFWERKS

qcrA

Cytochrome bc1 complex Rieske iron-sulfur subunit

406 amino acids

Iron-sulfur subunit of the cytochrome bc1 complex, an essential component of the respiratory electron transport chain required for ATP synthesis. The bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain. The bc1 complex operates through a Q-cycle mechanism that couples electron transfer to generation of the proton gradient that drives ATP synthesis.

44.957 kDa

MSNNPEMNYTSKELDAMSNEELARLGTELDGVTVAYRKERFPVEGDPASKRASRTVGIWFGIGIVSALAFLAVYLFMPWEYKGLGEDGLWIYTFYTPLLGLTSGLAILSLGIGVIFYIKKIIPSEISVQRRHDGPSEEIDRRTITALLNDSWETSTLGRRKVLKSMLGIGGVLAGLTIIAPLGGMVKNPWKKGELGIQGDGTLWTSGWTLHEKGVKLYLGRDTGVTAEKHETSVGTHYSTQGVSRLIRMRPEDLAAAAMETVFPLPAEFVNDGDKYDASADVYEEQMHSIHGPRNAVMLIRLRNSDANKVIEREGQEDFHYGDYYAYSKICTHIGCPTSLYEAQTNRILCPCHQSQFDALHYGKPVFGPAARALPQLPITVDEEGYLVAAGNFIEPVGPAFWERRS

qcrA

Cytochrome bc1 complex Rieske iron-sulfur subunit

353 amino acids

Iron-sulfur subunit of the cytochrome bc1 complex, an essential component of the respiratory electron transport chain required for ATP synthesis. The bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain. The bc1 complex operates through a Q-cycle mechanism that couples electron transfer to generation of the proton gradient that drives ATP synthesis.

38.574 kDa

MSSQDIPEENLPAEQDRPHGAAARPADETNPFADPGLPPHEPRVQDVDERAAKRSERTVALLFTLSMLATIAFIAAFVAIDVDKSVYIFPLGHISALNFALGMTLGVALFAIGAGAVHWARTLMSDEEVADERHPIEASPEVRAKVHADFKQGAKESVIGRRKLIRNTMLGALTLVPLSGVVLLRDLGPLPGTKLRHTLWSKGKLLVNMNTNEPLRPSDVAVGSLTFAMPEGLEEHDEDFQNEIAKAALMIIRLEPDSIKDKRELEWSHEGIVAYSKICTHVGCPISLYEQQTHHALCPCHQSTFDLADGARVIFGPAGHALPQLRIGVNDEGYLEALGDFEEPVGPAYWERG

qcrA

Cytochrome bc1 complex Rieske iron-sulfur subunit

170 amino acids

Iron-sulfur subunit of the cytochrome bc1 complex, an essential component of the respiratory electron transport chain required for ATP synthesis. The bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain. The bc1 complex operates through a Q-cycle mechanism that couples electron transfer to generation of the proton gradient that drives ATP synthesis.

18.94 kDa

single

WRDLGPLPGTKLRHTLWSKGKLLVNMNTNEPLRPSDVAVGSLTFAMPEGLEEHDEDFQNEIAKAALMIIRLEPDSIKDKRELEWSHEGIVAYSKICTHVGCPISLYEQQTHHALCPCHQSTFDLADGARVIFGPAGHALPQLRIGVNDEGYLEALGDFEEPVGPAYWERG

qcrA

Menaquinol-cytochrome c reductase iron-sulfur subunit

169 amino acids

Component of the menaquinol-cytochrome c reductase complex. The Rieske protein is a high potential 2Fe-2S protein.

19.144 kDa

MSDNKHRVTRRQFLNYTLTGVGGFMAAGMLMPMLRFAFDPILRETAGTDMVAVADVKEITTEPKRFDFKVKVKDAWYESEEPRSAWVYKDEKGDIIALSPVCKHLGCTVDWNTDKNNPNHFFCPCHYGLYTKDGTNVPGTPPTAPLDRYEFEVKDGKLYLGKAKPRGEA

qcrA

Menaquinol-cytochrome c reductase iron-sulfur subunit

167 amino acids

Component of the menaquinol-cytochrome c reductase complex. The Rieske protein is a high potential 2Fe-2S protein.

18.736 kDa

MGGKHDISRRQFLNYTLTGVGGFMAASMLMPMVRFALDPVLKSTGKQDMVQVVSVDELTKEPQRFDFKINQVDAWYESEESRSAWVFKNGDEIVALSPICKHLGCTVNWNSDPKNPNKFFCPCHYGLYEKDGTNVPGTPPLAPLDHYEQEVKDGFLYLGKAKPKGEG