psmB2

Proteasome subunit beta 2

237 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

24.63 kDa

MNNWSQGSTPQGSDPSPYAPELGSLPDGSQSDDHGDTVNKTGTTTIGITTDEGVVIATDMRASLGGRFVSNKNVQKVEQIHPTGALTLVGSVGGAQSFIRTLRAEVNLYESRRGEPMPIEALATLAGNFARGGPFRAINPILGGVDEEGSHVYSIDPAGGVMADDYTVTGSGMQLAYGLLEQEYEEGLSLEEAQSVAARAIESAVERDTGSGNGVFLAAVTGEGVDIQGHNDFDAVI

psmB2

Proteasome subunit beta 2

230 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

24.274 kDa

MHDPENRLTDAYEPEVGNLPNEDSGRDEENVVKTGTTTVGLSTEDGVIIATDRRASLGGRFVSNKQVQKVEQIHPTAAMTLVGSVGGAQSFIRSLRAEADLYEVRRDEPLSIHALATLAGNFARGGPYFAINPIVGGVDEEGSHVYSVDPAGGVLEDDYTVTGSGTMVATGTIEGQYDHGMSLSEARDLAIRAVNAAAERDTGSGNGVVLAEITDEGVEIDAFDDYESAE

psmB2

Proteasome subunit beta 2

219 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

23.702 kDa

MAEWIAGGLEGPAGRGLDERVVRSGTTTVGLIASDHVILAADKRATAGFLIASRRVKKIVMLSNYVAMTVSGLVADAQILSDVLREEIRLYEMTNKVKPSVRFVASLLSNILFSSKFFPYIVQLIVGGYDTQPRLYTLDLFGSITEDKYTATGSGSPIAYGVLEERYREDLSVEEAIKVATTAIRSAVLRDAASGDGADVVVIGPQGYEEKFIPYNSLV

psmB2

Proteasome subunit beta 2

212 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

23.761 kDa

MLHHPGTGQLRALKGTTTVGIVFRDFVVLAADRRATAGYFVAHKRTKKIIKITDYMAMTTAGLVADAQMLAEWLANHTHYYEIVNKRRMSIHAAAQYLSIILHSAKFYPYIVQLLLGGYDTQPRLYNIDWFGSVTEEKYVATGSGSPTAIGVIEDQYSPNLSMEEAVELAKRAVASSIRRDTFTGNGVDVVVIGKDFYREYSFELKDILKTK

psmB2

Proteasome subunit beta 2

212 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

23.308 kDa

MSVDEKVARALKGTTTVGIRSEKAVVLAADKRATAGNFIVHKRVEKIVKISDYMAMTTAGLVADAQVLADVLRMEVKNYELFHKKRMSVKAAATFLSNVLHSARFYPYIVQLLVGGFDTAPRLYSLDWFGTVAEEEFLVTGSGSPMAVGVIEAEYNPNMDLEELVNLAVRAVFAATRRDTASGEGIDVAVIDRNGITMRHYRLGDVIRLVRP

psmB2

Proteasome subunit beta 2

211 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

23.271 kDa

MVIMGNELQLENKILKGTTTVGIRVNDGVILAADRRASAGFFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSITKYGPISIKGIATRLANVLSATKYFPYIVQILIGGYDDQPRLFNLDYLGDITEENYVATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGTGVIVAKIHSKGHEELEFYLNKKM

psmB2

Proteasome subunit beta 2

211 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

23.223 kDa

MVIMGNKLQLENKILKGTTTVGIKVNDGVVLAADRRASAGFFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNNITKYGPISIKGIATRLANVLSATKYFPYIVQILIGGYDDQPRLFNLDYLGDITEENYVATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGTGVIVAKIHSKGHEELEFYLNKKV

psmB2

Proteasome subunit beta 2

210 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.83 kDa

MSNNVEEKILHGTTTVGIKAKDGVVLCADMRASAGYFIANNNTMKIQKIDDHAGLTLAGGVADAQNIVDILRYHSNLHRVEKHGPISIHSLARLCSLIFHQNRGYPFMADILVGGYDAEGPALFNIDMFGSVEKKAYVTTGSGSPVAYGLLEEEYREDLTVEEAKKIALRAVKAAIVRNIGTGDGINIAIMDKDGFRLLTEEQKKAVIEL

psmB2

Proteasome subunit beta 2

210 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.452 kDa

MSNNVEEKILHGTTTVGIKATDGVVLCADMRASAGYFIANNNTMKIQRIDDHAGLTLAGGVADAQNIVDVLRYHASLHRIRKQGPIPIKSLARLTSLIFHQNRGYPFMADILMGGFDAVGPALYNIDMFGSVEEKSYVTTGSGSPVAYGTLEEEYRADLTADEAKGVALRAVKAAITRNIGTGDGINVAVINGNGFELLTREQKKAVIAL

psmB2

Proteasome subunit beta 2

208 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.927 kDa

MGNELQLENKILKGTTTVGIRVNDGVILAADRRASAGFFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSITKYGPISIKGIATRLANVLSATKYFPYIVQILIGGYDDQPRLFNLDYLGDITEENYVATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGTGVIVAKIHSKGHEELEFYLNKKM

psmB2

Proteasome subunit beta 2

208 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.601 kDa

MSGKKIVSKTTTVGIVVGDYVVLAADKRATAGSLVAHKRVKKIIRIDDYIAMTISGLVADAEIIAEQARFIARKYKLELGRPIKVSALASNLSIILNAYLRMSPYIVQLLLGGYDDNGPHLFYIDLFGSLSEEKYMATGSGSPTAFGVLEEEYRSDLSLDEAKELAFKAVSAATKRDGFSGEGVDIVVIGPNTYVEETKLFKRSIIAK

psmB2

Proteasome subunit beta 2

207 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.671 kDa

MLQLTEKFKGTTTVGIVCSDGVVLAADRRASLGNIVYAKNVTKIHKIDEHLAIAGAGDVGDILNLVRLLRAEAKLYYAQSGKRMSVKALATLLANMLNGARMLPYLAWFLVGGFDEKPRLYSVDMMGGITEDKYVAAGSGMEFAYSVLDSEYREDLKVREGIKIAVEAINSAIKRDVFSGDGIMVVTITEEGYRELSNSRLKAILRQ

psmB2

Proteasome subunit beta 2

207 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.598 kDa

MLQLTEKFKGTTTVGIVCKDGVVLAADRRASLGNIIYARNVTKIHKIDEHLAIAGAGDVGDILNLVRLLRAEAKLYYSQSGKRMSVKALATLLANIMNGAKYFPYLAWFLVGGYDEKPKLYSVDMVGGITEDKYATAGSGMEFAYSILDSEYKDNLTLEEGIKLAVKAINTAIKRDVFSGDGILVVTITKEGYKELSDSELEATLKQ

psmB2

Proteasome subunit beta 2

207 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

23.041 kDa

METNNKLKILKTGTTTVGIKVKDGVVLAADRRASAGMYVAHKYVRKVLYVAPNIGITTAGSVADLQFIYDLLKNIYHYNLITGMRPITIKALATYLANMLSFSKYLPYIVQILIGGVDEQPRLYNLDYVGDITEEDYTATGSGSVEAIGVIEDEYRPDMTLDEAADLARRAIFSSIKRDPYTGTGVIVSKITKNGHEEKEYYPQRKI

psmB2

Proteasome subunit beta 2

206 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.384 kDa

MLHLKEKLKGTTTVGLVCKEGVVLAADTRASLGNIIYAKNVTKIHKIDEHLAIAGAGDVGDILNLVRLLKAEANLYKSTVGKEMSVKALATLLANILNGSKYFPYLGWFLVGGYDEKPRLFSVDMVGGITEDNYAAAGSGMEFAYSILDSEYREEMSVNDGIKLAVKAINVAIKRDVFTGDGLLVVTITKDGYKEYRGAELEKMLK

psmB2

Proteasome subunit beta 2

206 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.27 kDa

MREAVSKTTTVGLVTGDYVVLAADKRATAGPMVYHKAVKKISKITDYAALTISGLVADAQYIVENARYIAREYEIEMGGPIPIKALASRISLILSVYLRYSPFIVQLLLGGRDSTGASLYYMDLYGSVTREKYMATGSGSPVAFGILEKNYRSDLSLEEAKKLAFNAVSSAIMRDGFSGEGVDIVVIGPGIYSEETIPLKKTIESS

psmB2

Proteasome subunit beta 2

204 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.161 kDa

MEVLPGTTVGIRVSDGVVLAAEKRVSYGLYLMSKSGKKVYRILDKMGMASAGLMADMQTLARIVEAEMRLYELDSNISPKVWTVAKLLSYILYERRLFPYYAEIVVGGLDEEGSHLYSLDPIGAIIEDDYVALGSGTQLAISIVESNYKKDMSLDEALSLALKSVYAAMKRDAASGDGVDVLVIGKSGTLEKTYPLSELQSVAV

psmB2

Proteasome subunit beta 2

203 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.716 kDa

MGEEVQIGATAVGIKAKDGVVLAAEKRVSYGFYTLSSAGKKVFVIDDKLAIASAGIIADMQTLAKILKLNAKAYELEMKRKPSTHSMARLLSVIMFSRRFMPFFAEVLVGGIDEEGPHLIVMDPLGSLIEDNYAALGTGAKLAVAVLDTGYRPDITVEEAKKLAVQALKAAIERDPVSGGGIDLAIVDKNGAREEEVRVQLLI

psmB2

Proteasome subunit beta 2

203 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.743 kDa

MGEEVQIGATAVGIKAKDGVVLAAEKRVSYGFYTLSSAGRKVFVIDDKLAIASAGIIADMQSLARIVKINAKAYELETRKKPTVRSMAKLLSVIMFSRRYMPFFAEVLVGGVDEEGSHLIVMDPLGSLIEDNYAALGTGAKLAISVLDTGYREDITLQDAKKLAVKALKAAIERDPVSGGGIDLVLIDQTGAKEEEVKVQLLI

psmB2

Proteasome subunit beta 2

203 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.69 kDa

MGEEVSIGATAVGIKTKEGVVLAAEKRVSYGFYTLSTAGKKVFIVNDRLAIASAGIIADMQTLAKILKLNAKAYELEMKRKPSVHAMAKLLSVVMFSRRFMPFFAEVLVGGIDDEGPHLIVMDPLGSLIEDNYAALGTGAKLAIAIIDASYKPDMSLQDAKKLAVQALKAALERDPVSGGGIDLVVIDKNGAREEEVKLQVLI

psmB2

Proteasome subunit beta 2

203 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.556 kDa

MGEEFQVGATAVGIRAKDGVVLAAEKRVSYGFYTLSTAGKKVFIVNDKLAIASAGIIADMQALAKILKLNARSYELEVKKKPTVKAMAKLLSVVMFSRRFMPFYAEVLVGGVDEEGPHLIVMDPLGSLIEDNYAALGTGAKLAVSLLDASYRPDMTVEEAKKLAVQAVKAAIERDPVSGGGIDLVVVDGGGAREEEVKVQVVI

psmB2

Proteasome subunit beta 2

203 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.432 kDa

MNLQNKILKGTTTVGIKVKDGVVLAADRRASAGYYVAHKYVRKVLYVTDNIGITTAGSVADLQFIYEALKYIYHRNSITGEGPITVKGIATWLANVLSSSKYFPYLVQILIGGVDDQPRLYNLDYLGDITEEEYTATGSGSPEALGVLEDNYKPEMSLDEAAELAKRAIFSSIKRDSFTGTGVIVTKITKNGHEEKEYYITKR

Psmb2

Proteasome subunit beta type-2

201 amino acids

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Belongs to the peptidase T1B family.

22.906 kDa

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIAFPKRDS

Psmb2

Proteasome subunit beta type-2

201 amino acids

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Belongs to the peptidase T1B family.

22.912 kDa

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENITFTKRSS

PSMB2

Proteasome subunit beta type-2

201 amino acids

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Belongs to the peptidase T1B family.

22.896 kDa

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADYLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISREKAVELLRKCLEELQKRFILNLPTFSVRIIDRNGIHDLDNISFPKQGS

PSMB2

Proteasome subunit beta type-2

201 amino acids

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Belongs to the peptidase T1B family.

22.836 kDa

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

psmB2

Proteasome subunit beta 2

200 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.149 kDa

MTTTVGIAVKEGVVLATDKRVTAGYYIAHKQGEKIWKIDDHVAATMSGGVADLQSLLSFLTLRAREYKIEYKRPIPIRALVNYVSLILFYSRPYIYLVHSIIGGVDREEGAVLYMVDWLGTVTRERYIATGSGSPYAKGALEVGYREDMSLEDAVDLAIRSVKAAIRNDPGSGEGIDVVVITKEGFRRVFTAQQKIIITE

psmB2

Proteasome subunit beta 2

200 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.484 kDa

MSDQLELMTGTTVGIKAKDGVVLAAEKRVSYGFYLMSKSGKKVYPITNRIGLASSGILADIQTITKVIRANIANMEIEMKRPVSVRAAAKLLSIMLFQNKYMPYIAETMVGGIDEEGPKLFILDSWGSLIEDDFAALGNGARTAIGLIETGYSSSITVKEAKELAIKAIKEAIARDPTSGDGIDTLVITGNGYLEDSIKL

psmB2

Proteasome subunit beta 2

200 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

22.02 kDa

MEEKKTGTTTVGIKVKEGVVLAADTQASLGNMVETLNIRKILPITDRIAITTAGSVGDVQALARMLEAQARYYQFTWGRPMTTRAMANLLSNILNENKWFPYMVQIIIGGYVDKPELASVDALGGLVFEKYTATGSGSPFAIAIIEDGYREDMSIEEAKELAVRAVKTAGKRDVYTGERKVQVVVITKDGMKEEFVEFKE

psmB2

Proteasome subunit beta 2

200 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.753 kDa

METKKTGTTTVGIKAKDGIVLAADTQASLGHMVETLNIRKIIPITDRIAITTAGSVGDVQALARMLEAEARYYQFTWGKPMSTKAMANLLSNILNGNKWFPYLVQIILGGYVEEPTLANLDPLGGLIFDDYTATGSGSPFAIAVLEDGYKKDMSIEEAKELAVRAVRTAGKRDVYTGSRKIQIVAITKEGITEEFVEFND

psmB2

Proteasome subunit beta 2

199 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.978 kDa

MEKKTGTTTVGIRTKEGVVLAADTQASLDHMVETLNIRKILPITDRIAITTAGSVGDVQALARMLEAEARYYQFTWGRPMTAKAMAHLLSNILNENKWFPYMVQIIIGGYVEEPTLANLDPLGGLIFDDYTATGSGSPFAIAVLEDGFRKDMSLEEAKELAVRAVRTAGKRDVYTGDRKVQVVVISKDGMKEEFVEFKE

psmB2

Proteasome subunit beta 2

199 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.905 kDa

MEKKTGTTTVGIKLKDGVVLAADTQASLDHMVETLNIKKILPITDRIAITTAGSVGDLQALARMLEAEAKYYQFTWGKPMTAKAMANLLSNILNESKWFPYMVQIIIGGYVEEPTLASLDPLGGLIFDNYTTTGSGSPFAIAILEDGYKEDMSIEDARELAIKAVRTAGKRDVYTGERKIQVITITKEGMKEEFVEFKE

psmB2

Proteasome subunit beta 2

198 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.362 kDa

MVLATALGLRFDGGVVLAADRRVSYNGFILSKSARKVFLINERVGVSTAGLPGDFQELVDVLKYNITMYELENEKAATPTNVAKLLSILLYQGRFSGIYYAELVVGGIDNSGPKIFVLDPAGGLMEENFSAVGSGAQIATGILERFFKEGMSEKEAVELAERAMREAISRDALSGDGIDLLIITSKGSRMEFIPVRTA

psmB2

Proteasome subunit beta type-2

198 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a chymotrypsin-like activity (By similarity).

Belongs to the peptidase T1B family.

22.11 kDa

METLLAFKVKGGVLCLADSSVNHSIVKMKDDEDKILEIDGHKLLLSAGEAGDRVQFTEYISKNIKLYSLRNSYPMSTPAAANFIRNELATSIRSHPYSINLILAGYDKEVEDGGTSLYYMDYLGSLQKLNFGCHGYASYFLLGLLDRHHKCDLSLEDGINLMHLCTTELKTRFLVSGKYTLKFVSSEGIKVLPFNAPQ

psmB2

Proteasome subunit beta 2

196 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.236 kDa

MEELPSTAVGIRLQDGVILGAVRRLSYGGYVLSKSAKKVFPISRFGIGGAGLFGDLQALTRIMNANIKYYELYNNRPISTRAAAKLLSIILYQYKYMPFISEVLFGGVDNGEPQLYVLDPLGSLLDDIYAAVGSGARVAIGVLEAEYSEKLTLTQGRELTIKSLRASAERDVTSGDGIDILTISKDGKINTEFLSS

psmB2

Proteasome subunit beta 2

196 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.35 kDa

MEELPATAIGLKVNDGIVLASERRLSYGGYVLSKQAKKVHKIGKFLMAGAGIYGDLQTLTRIMNVEIKYYEISTGKPISVHAAAKLLSVILYQYKVMPFISEILFGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGDGIDLAIMDKKGNYENKFIPY

psmB2

Proteasome subunit beta 2

196 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.35 kDa

MEELPATAIGLKVNDGIVLASERRLSYGGYVLSKQAKKVHKIGKFLMAGAGIYGDLQTLTRIMNVEIKYYEISTGKPISVHAAAKLLSVILYQYKVMPFISEILFGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGDGIDLAIMDKKGNYENKFIPY

psmB2

Proteasome subunit beta 2

196 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.35 kDa

MEELPATAIGLKVNDGIVLASERRLSYGGYVLSKQAKKVHKIGKFLMAGAGIYGDLQTLTRIMNVEIKYYEISTGKPISVHAAAKLLSVILYQYKVMPFISEILFGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGDGIDLAIMDKKGNYENKFIPY

psmB2

Proteasome subunit beta 2

196 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.35 kDa

MEELPATAIGLKVNDGIVLASERRLSYGGYVLSKQAKKVHKIGKFLMAGAGIYGDLQTLTRIMNVEIKYYEISTGKPISVHAAAKLLSVILYQYKVMPFISEILFGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGDGIDLAIMDKKGNYENKFIPY

psmB2

Proteasome subunit beta 2

196 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.35 kDa

MEELPATAIGLKVNDGIVLASERRLSYGGYVLSKQAKKVHKIGKFLMAGAGIYGDLQTLTRIMNVEIKYYEISTGKPISVHAAAKLLSVILYQYKVMPFISEILFGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGDGIDLAIMDKKGNYENKFIPY

psmB2

Proteasome subunit beta 2

196 amino acids

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Belongs to the peptidase T1B family.

21.35 kDa

MEELPATAIGLKVNDGIVLASERRLSYGGYVLSKQAKKVHKIGKFLMAGAGIYGDLQTLTRIMNVEIKYYEISTGKPISVHAAAKLLSVILYQYKVMPFISEILFGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGDGIDLAIMDKKGNYENKFIPY