PSMA3

Proteasome subunit alpha type-3

255 amino acids

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.

Belongs to the peptidase T1A family.

28.433 kDa

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Psma3

Proteasome subunit alpha type-3

255 amino acids

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.

Belongs to the peptidase T1A family.

28.405 kDa

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Psma3

Proteasome subunit alpha type-3

255 amino acids

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.

Belongs to the peptidase T1A family.

28.419 kDa

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYAKESLKEEDESDDDNM

PSMA3

Proteasome subunit alpha type-3

255 amino acids

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.

Belongs to the peptidase T1A family.

28.405 kDa

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGEITNGRHEIVPKDVREEAEKYAKESLKEEDESDDDNM

psmA3

Proteasome subunit alpha type-3

248 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.

Belongs to the peptidase T1A family.

27.238 kDa

MSSVGSGYDLYVSTYSPDGKLFQVDYANKAVENSGTLVAIKAKDGVVLGVEKLVPSKMLCSGSNRRVHHIDTHVGVAIAGFLADARQLITRARSEAKNYKSTYGQPIPIKVLSQRIASYNHMHTLYGSVRPFGCSIAITGIDQYGPQLFLVEPSGSCVGYFGASLGKGKQAAKNELEKIKFSEMTCREAIKEVSRIIYSVHDEVKDKDFELELGWISTETNNVHQIVPKELHDEAEAYAKQSLEDANM

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection. Stimulates the secretion of the chemotactic factor interleukin-8 (IL-8). The ensuing activation process triggers an inflammatory response in the host, thus contributing greatly to virulence. Also possesses hemolytic activity, which may contribute to the development of disease.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.656 kDa

MEFVAKLFKFFKDLLGKFLGNY

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN

psmA3

Phenol-soluble modulin alpha 3 peptide

22 amino acids

Peptide which can recruit, activate and subsequently lyse human neutrophils, thus eliminating the main cellular defense against infection. Stimulates the secretion of the chemotactic factor interleukin-8 (IL-8). Showed the most pronounced proinflammatory and cytolytic activities in the host, thus contributing greatly to virulence and possibly to the development of disease.

Belongs to the phenol-soluble modulin alpha peptides family.

2.607 kDa

MEFVAKLFKFFKDLLGKFLGNN