psbM

Photosystem II reaction center protein M

52 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.579 kDa

METTSFGFAASLLFVGVPTIFLIGLFVSTSDGEKSSFYSDTSKGRLSPEPKK

psbM

Photosystem II reaction center protein M

52 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.579 kDa

METTSFGFAASLLFVGVPTIFLIGLFVSTSDGEKSSFYSDTSKGRLSPEPKK

psbM

Photosystem II reaction center protein M

50 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.389 kDa

METTNFGFVASLLFVGVPTIFLIGLFISTQDGEKSSFYSDSGKGKLGPKR

psbM

Photosystem II reaction center protein M

50 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.417 kDa

METTNFGFIASLLFVGVPTIFLIGLFISTQDGEKSSFFSDSSKGKLGPKR

psbM

Photosystem II reaction center protein M

50 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.365 kDa

METTNFGFIISLLFVGIPTIFLVGLYISTSDGEKSSFFSDSSKGKLGPKS

psbM

Photosystem II reaction center protein M

50 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.433 kDa

METTNFGFVASLLFVGIPTIFLIGLFISTQDGEKSSFYSDSSKGKLGPKR

psbM

Photosystem II reaction center protein M

50 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.447 kDa

METTNFGFVASLLFVGVPTIFLIGLFISTQDGEKSSFYSDSSKGRLGPKR

psbM

Photosystem II reaction center protein M

50 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.447 kDa

METTNFGFVASLLFVGVPTIFLIGLFISTQDGEKSSFYSDSSKGRLGPKR

psbM

Photosystem II reaction center protein M

50 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

5.461 kDa

METTNFGFVASLLFVGVPTIFLIGLFLSTQEGEKSSFYSDSGKGKLDPKR

psbM

Photosystem II reaction center protein M

38 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

4.325 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTETQNKNKKD

psbM

Photosystem II reaction center protein M

38 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

4.155 kDa

MQVNDLGFVASILFVLVPTVFLLILYIQTASRQGGKDS

psbM

Photosystem II reaction center protein M

38 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

4.213 kDa

MQVNDLGFVASILFVLVPSVFLIILYIQTASREGKKDS

psbM

Photosystem II reaction center protein M

38 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

4.191 kDa

MEVNILGLIATALFIVIPTSFLLILYIQTVASAKQQEQ

psbM

Photosystem II reaction center protein M

37 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

4.089 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVGQSDSFE

psbM

Photosystem II reaction center protein M

37 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.902 kDa

MEVNNLGFIAVLMFLAIPTAFLLIPYVKTASASSGSN

psbM

Photosystem II reaction center protein M

37 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.871 kDa

MEVNTLAFIAVLLFLAVPTAFLLIPYVKTASASSGSN

psbM

Photosystem II reaction center protein M

36 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.964 kDa

MEVNILGVIAVALFILIPTSFLLILYVKTSAENKDN

psbM

Photosystem II reaction center protein M

36 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.977 kDa

METNDLGFVASLMFVLVPTVFLIVLFIQTNSREGSS

psbM

Photosystem II reaction center protein M

36 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface. Probably involved in dimerization of PSII; at the monomer-monomer interface the only protein-protein contacts observed are between the 2 PsbM subunits. Lipids, chlorophylls and carotenoids contribute strongly to PSII dimerization.

Belongs to the PsbM family.

3.981 kDa

MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS

psbM

Photosystem II reaction center protein M

36 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation (PubMed:19433803, PubMed:23426624). This subunit is found at the monomer-monomer interface. Probably involved in dimerization of PSII; at the monomer-monomer interface the only protein-protein contacts observed are between the 2 PsbM subunits. Lipids, chlorophylls and carotenoids contribute strongly to PSII dimerization.

Belongs to the PsbM family.

4.015 kDa

MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS

psbM

Photosystem II reaction center protein M

36 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.867 kDa

MEVNILGLIATALFIIIPTSFLLILYVQTASQGSKS

psbM

Photosystem II reaction center protein M

36 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

4.008 kDa

MEVNILGVIATALFIIIPTSFLLILYVKTASQEQEQ

psbM

Photosystem II reaction center protein M

36 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

4.068 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTESQNKKN

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.781 kDa

MEVNILAVIATALFIIIPTSFLLILYVKTASQADS

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.911 kDa

MQVNELGFLASLLFVLVPSVFLIVLYIQTASREAK

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.857 kDa

METNYLGLLATILVILVPSIFLVILYVQTSSKSES

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.809 kDa

MEVNILAFVATALFILIPTAFLLILYIQTAAQNNG

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.869 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSVE

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.954 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTESQNKK

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.966 kDa

MQVNNLGFIASILFVLVPTVFLLILFIQTRQETEG

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.881 kDa

MEVNILGLIATALFILIPTSFLIILYVKTEAVNDM

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.911 kDa

MQVNELGFLASLLFVLVPSVFLIVLYIQTASREAK

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface (By similarity). Involved in assembly of monomeric PSII from the CP43-less intermediate.

Belongs to the PsbM family.

3.882 kDa

MQVNNLGFIASILFVLVPTVFLLILFIQTGKQSES

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.83 kDa

MEVNIFGLTATALFIIIPTSFLLILYVKTASNQSV

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.829 kDa

MEVNILAFIATALFIIIPTAFLLILYVKTASQSDS

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

4.029 kDa

MEVNDLGFIATILFVLVPTVFLLILYIQTREETES

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.997 kDa

MQVNDLGFIATILFVLVPTVFLLILYIQTRKETEG

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.997 kDa

MQVNDLGFIATILFVLVPTVFLLILYIQTRKETEG

psbM

Photosystem II reaction center protein M

35 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.954 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTESQNKK

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.775 kDa

MPVNNFGFLATLLFVAVPMLFLIGLYIQTNSNKS

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.712 kDa

MEVNILAFIATALFISIPTAFLLIPYVQTATQSN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.755 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTASQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.755 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTASQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.755 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTASQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.681 kDa

MEVNILGLTATALFIIIPTSFLLILYVKTASNEA

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.613 kDa

MPVNDLGAIATALFVFIPCVFLILLYAQTASRGS

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.797 kDa

MEVNILAFIATALFILIPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.797 kDa

MEVNILAFIATALFILIPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.769 kDa

MEVNILAFIATALFILIPTAFLLIIYVKTASQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.752 kDa

MEVNILAFIATALFILIPTAFLLILYVQTAAQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.683 kDa

MEVNILAFIATALFILIPTAFLLILYVQTASQGS

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.782 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.755 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTASQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.782 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.749 kDa

MEVNILALIAIALFISVPTAFLIIIYVKTISENN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.812 kDa

MEVNILAFIATALFILIPTSFLLIIYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.741 kDa

MEVNILAFIATALFILIPTAFSLILYVQTASQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.782 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.782 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.797 kDa

MEVNILAFIATALFILIPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.755 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTASQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.74 kDa

MEVNILAFIATALFILIPTAFLLILYVQTASQNS

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.77 kDa

MEVNILAFIATALFILIPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.797 kDa

MEVNILAFIATALFILIPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.75 kDa

MEVNILGLIATALFIIIPTSFLLILYVKTASQQN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.798 kDa

MQVNDLGFIATILFVLVPTVFLLILYIQTNKTAS

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.77 kDa

METNDLGFVASLLFVLVPTVFLIILFIQTNSKEG

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.757 kDa

METNDLGFVASLLFILVPAIFLIVLYIGTNRSES

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.813 kDa

METNDLGFVATLLFVLVPAIFLIILYIQTNSREG

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.759 kDa

METNDLGFVASLMFILVPAIFLIVLYIGTNRSEA

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.758 kDa

METNDLGFVASLMFILVPAIFLIVLYIGTQNNEA

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface (By similarity). Plays a role in ensuring efficient and functional forward, backward and internal electron flow in PSII (PubMed:17261590).

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.684 kDa

MEVNILGLMAVALFILIPTSFLLILYVKTASSSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.782 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.735 kDa

MEVNILALIAVALFISIPTAFLVIIYVKTISENN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.798 kDa

MEVNILAFIATALFILVPTSFLLIIYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.716 kDa

MEVNILAFIATALFVLIPTAFLIILYVKTESSSS

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSKND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.622 kDa

MEVNILAVIATALFVLIPTAFLLILYVKTESAGS

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.761 kDa

MEVNIYGLTATALFIIIPTSFLLILYVKTASTQD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.772 kDa

MEVNILAFIATTLFVLVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.782 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.77 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTISQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.736 kDa

MEVNILAFSATALLILFPTALLLILYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.736 kDa

MEVNILAFSATALLILFPTALLLILYVKTVSQNN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.77 kDa

MEVNILAFIAIVLFISVPTAFLLIIYVKTVSESN

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSKSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.683 kDa

MEVNILAFIATALFILIPTAFLLILYVQTASQGS

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.811 kDa

MEVNILAFIATVLFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.783 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.796 kDa

MEVNILGLIATTLFILIPTSFLLILYVKTASQEE

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.756 kDa

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

psbM

Photosystem II reaction center protein M

34 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.775 kDa

MPVNNFGFLATLLFVAVPMLFLIGLYIQTNSNKS

psbM

Photosystem II reaction center protein M

31 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.453 kDa

METNILALMATALFIIIPTAFLIILYAQTNK

psbM

Photosystem II reaction center protein M

31 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.404 kDa

MEVNILAFIATALLILVPTAFLLIIYVKTAK

psbM

Photosystem II reaction center protein M

31 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface.

Belongs to the PsbM family.

3.363 kDa

MEVNILAFIATALLILVPTAFLLIIYVKTAS