psb27

Photosystem II lipoprotein Psb27

134 amino acids

Plays a role in the repair and/or biogenesis of the calcium-manganese-oxide cluster on the lumenal face of the thylakoid membrane. Photosystem II (PSII) complexes containing this protein are monomeric, are assembly intermediates lacking the calcium-manganese-oxide cluster and miss some of the lumenal subunits. Probably blocks binding of some of the small lumenal subunits.

Belongs to the Psb27 family.

14.786 kDa

MSFLKNQLSRLLALILVVAIGLTACDSGTGLTGNYSQDTLTVIATLREAIDLPQDAPNRQEVQDTARGQINDYISRYRRKGDAGGLKSFTTMQTALNSLAGYYTSYGARPIPEKLKKRLQLEFTQAERSIERGV

psb27

Photosystem II lipoprotein Psb27

134 amino acids

Plays a role in the repair and/or biogenesis of the calcium-manganese-oxide cluster on the lumenal face of the thylakoid membrane. Its presence in a photosystem II (PSII) preparation prevents binding of other extrinsic subunits PsbO, PsbU and PsbV, and thus assembly of calcium-manganese-oxide cluster. Psb27-containing complexes lack oxygen evolving activity and an oxidizable calcium-manganese-oxide cluster, but have a normal reaction center.

Belongs to the Psb27 family.

15.1 kDa

MKRFWAMVCALFLSVSLLLTSCANVPTGLTGNFREDTLALISSLREAIALPENDPNKKAAQAEARKKLNDFFALYRRDDSLRSLSSFMTMQTALNSLAGHYSSYPNRPLPEKLKARLEQEFKQVELALDREAKS