PRE8

Proteasome subunit alpha type-2

250 amino acids

The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity.

Belongs to the peptidase T1A family.

27.162 kDa

MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

pre8

Probable proteasome subunit alpha type-2

245 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity).

Belongs to the peptidase T1A family.

26.404 kDa

MTDKYAFSLTTFSPNGKLVQIEYALNAVNAGVTSVGIKATDGVVLATEKKPTSELAIGASLEKVCAITPDIGMVYSGMGPDFRVLVDKSRKVAQTTYKKIYNEYPPTKILVQEIASVMQESTQSGGVRPFGVSLLVAGMDEKGPSLYQVDPSGTYFAWKATAIGKSSTAAKTFLEKRYNDELELDDAVHTAILALKETFEGELTEDNIEIAVVSTKPTDSGIVGVPGGHFCRLSQSEIRDYLDQV