ppp6c

Serine/threonine-protein phosphatase 6 catalytic subunit

305 amino acids

Belongs to the PPP phosphatase family. PP-6 (PP-V) subfamily.

35.294 kDa

MSNALPLDEWVETARQCKYLPENDLKKLCERVKELLLEESNVQPVRSPVTICGDIHGQFYDLLELFKTGGEVPDTNYVFMGDFVDRGYYSLETFTYLLALKARYPDKITLLRGNHESRQITQVYGFYDECQQKYGNVNAWKYCTSVFDFLTLAAIIDGKVLCVHGGLSPKVRTLDQIRIISRNLEIPHEGPFCDLMWSDPEDIEQWQPSPRGAGWLFGSKVTAEFEHINGLNLICRAHQLVQEGYRYMFDNSLVTVWSAPNYCYRCGNVASILSLNENLDRDFKIFQAVQEERNIPTRPTMQYFF

PPP6C

Serine/threonine-protein phosphatase 6 catalytic subunit

305 amino acids

Catalytic subunit of protein phosphatase 6 (PP6) (PubMed:17079228, PubMed:29053956). PP6 is a component of a signaling pathway regulating cell cycle progression in response to IL2 receptor stimulation (PubMed:10227379). N-terminal domain restricts G1 to S phase progression in cancer cells, in part through control of cyclin D1 (PubMed:17568194). During mitosis, regulates spindle positioning (PubMed:27335426). Downregulates MAP3K7 kinase activation of the IL1 signaling pathway by dephosphorylation of MAP3K7 (PubMed:17079228). Participates also in the innate immune defense against viruses by desphosphorylating RIG-I/DDX58, an essential step that triggers RIG-I/DDX58-mediated signaling activation (PubMed:29053956).

Belongs to the PPP phosphatase family. PP-6 (PP-V) subfamily.

35.144 kDa

MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL

Ppp6c

Serine/threonine-protein phosphatase 6 catalytic subunit

305 amino acids

Catalytic subunit of protein phosphatase 6 (PP6). PP6 is a component of a signaling pathway regulating cell cycle progression in response to IL2 receptor stimulation. N-terminal domain restricts G1 to S phase progression in cancer cells, in part through control of cyclin D1. During mitosis, regulates spindle positioning. Downregulates MAP3K7 kinase activation of the IL1 signaling pathway by dephosphorylation of MAP3K7. Participates also in the innate immune defense against viruses by desphosphorylating RIG-I/DDX58, an essential step that triggers RIG-I/DDX58-mediated signaling activation.

Belongs to the PPP phosphatase family. PP-6 (PP-V) subfamily.

35.159 kDa

MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL

Ppp6c

Serine/threonine-protein phosphatase 6 catalytic subunit

305 amino acids

Catalytic subunit of protein phosphatase 6 (PP6). PP6 is a component of a signaling pathway regulating cell cycle progression in response to IL2 receptor stimulation. N-terminal domain restricts G1 to S phase progression in cancer cells, in part through control of cyclin D1. During mitosis, regulates spindle positioning. Downregulates MAP3K7 kinase activation of the IL1 signaling pathway by dephosphorylation of MAP3K7. Participates also in the innate immune defense against viruses by desphosphorylating RIG-I/DDX58, an essential step that triggers RIG-I/DDX58-mediated signaling activation.

Belongs to the PPP phosphatase family. PP-6 (PP-V) subfamily.

35.159 kDa

MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL