Function
Serine/threonine kinase which responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Phosphorylates snk-1 which probably regulates skn-1 nuclear translocation in response to oxidative stress (PubMed:16166371). Probably by activating skn-1, involved in the up-regulation of gcs-1 and glutathione-S-transferase gst-4 expression upon bacteria infection (PubMed:22216003). Up-regulates expression of gcs-1 in intestinal cells upon arsenite treatment (PubMed:16166371). Functions downstream of the MAPKK sek-1 and the MAPKKK nsy-1 as the MAP kinase which regulates pathogen resistance and responses to oxidative stress (PubMed:11703092, PubMed:12142542, PubMed:18394898, PubMed:16166371). Required for expression of antimicrobial peptide nlp-29 in response to fungal infection or physical injury (PubMed:18394898). Involved in resistance to the nematotoxic C.cinerea galectin Cgl2 (PubMed:20062796). May play a redundant role with other MAP kinases in susceptibility to anoxia, downstream of tir-1/nsy-1 (PubMed:21212236). Phosphorylates transcription factor rnt-1 during oxidative stress which results in rnt-1 stabilization in the intestine (PubMed:22308034). Probably downstream of nsy-1 and sek-1, involved in germline apoptosis induced by heavy metals, such as Cu(2+) (PubMed:19497412).
Sequence
MFPQTTMDHILHPTPREGYYVVELNRSVWVVPNYYINLTPIGTGAYGTVCAAECTRSGTRVAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLMGADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDFGLARQTDSEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVTGTPDEEFLKKISSEEARNYIRNLPKMTRRDFKRLFAQATPQAIDLLEKMLHLDPDRRPTAKEAMEHEYLAAYHDETDEPIAEEMDLNDDVRADTIDEWKKIIWEEISDFQKNVAFADEEEDEEKMES