pfd-6

Probable prefoldin subunit 6

128 amino acids

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Required for positioning of the mitotic spindle (By similarity).

Belongs to the prefoldin subunit beta family.

15.031 kDa

MADMAKFEEEISKLKTLEKDREKYFSSRQEMEMRLTESKNVKAELDLMDSDSKVYKLMGPVLVRQDLEEARSTVEKRLEFIESEIKRVEASITDVNKKSIEQRDKVMNMQKAFQMMATQAQQQAAQKK

pfd-6

Probable prefoldin subunit 6

126 amino acids

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity). Required for positioning of the mitotic spindle.

Belongs to the prefoldin subunit beta family.

14.737 kDa

MADMAKFEEEVNKLRTLEKDREKYFTSRQEMEMRLTESKNVKAELDLMESDSKVYKLIGAVLVRQDLEEARSTVEKRLEFIDSETKRVEASISDISKKCTEQRDKVMNMQKSFQMMAQAAAQAQKK