pepE

Aminopeptidase E

438 amino acids

Can hydrolyze internal peptide bonds in Met-enkephalin and bradykinin; however, hydrolysis of alpha-, beta-, and kappa-caseins is not detected.

Belongs to the peptidase C1 family.

50.022 kDa

MAHELTVQELEKFSADFNKNPKNKVVARAAQRSGVLEASYNDRVQSELTRVFSTELDTDNVTNQKHSGRCWLFATLNVLRHEFGKKYKAKDFTFSQAYNFFWDKIERANMFYNRILDSADMPLDSRQVKTDLDFAGTDGGQFQMAAALVEKYGVVPSYAMPETFNTNDTTGFATALGDKLKKDALVLRKLKQEGKDDEIKKTREKFLSEVYQMTAIAVGEPPKKFDLEYRDDDKKYHLEKDLTPLEFLHKYLGGVDFDDYVVLTNAPDHEYDKLYGLPAEDNVSGSIRIKLLNVPMEYLTAASIAQLKDGEAVWFGNDVLRQMDRKTGYLDTNLYKLDDLFGVDLKMSKADRLKTGVGEVSHAMTLVGVDEDNGEVRQWKVENSWGDKSGAKGYYVMNNEWFNDYVYEVVVHKKYLTDKQKELAEGPITDLPAWDSLA

pepE

Probable dipeptidase PepE

375 amino acids

Belongs to the peptidase M24B family.

39.44 kDa

MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAAGAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPALHMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYHSDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYFVHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAVSVNNCPHELIVVPVS

pepE

Probable dipeptidase PepE

375 amino acids

Belongs to the peptidase M24B family.

39.44 kDa

MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAAGAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPALHMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYHSDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYFVHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAVSVNNCPHELIVVPVS

pepE

Probable dipeptidase PepE

375 amino acids

Belongs to the peptidase M24B family.

39.44 kDa

MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAAGAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPALHMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYHSDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYFVHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAVSVNNCPHELIVVPVS

pepE

Peptidase E

243 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

26.236 kDa

MNLLLLSNSTQHGRGYLEHALDTVTGFLPAGARLAFVPYALADHDTYTARVRGALADAGIDVRGVHEGGDPLARLDEADAVFVGGGNSFRLLSALYRTGLREALVKAVRGGLPYMGASAGTNMAAPSLRTTNDMPIVEPPSFETLGLVPFQINPHYLDPDPGSTHKGETREERLREFLEENDVPVLGLREGSWLRVEGDRAVLGGERDARLFRRGTAPRELAVGSDLSELLDVRGEFDTGTRS

pepE

Peptidase E

242 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

27.458 kDa

MSKRLLLLSNSTNIGEEYLFYARQEIKNFLGSSVKKIAFIPFAAVTSTYQHYSEKVRKVFQDIGYEFDAIHLVESSHELIKNAEAVVVGGGNTFHLIHCLHETKLLDDIRNKVSNGTPYIGWSAGSNVACPTIKTSNDMPIIEPISFQGLNLVPFQINPHYTNAVIPNHNGETREQRLEDFLVLNPDIYVVGLPEGTMLKIEDSSIRLIGNKTIYLFKFGEEKQEYYPHDNLDFLLERASFT

pepE

Peptidase E

239 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.974 kDa

MTINALLLSSSRVGDTPYLAHAIPFIKPLTTNARKWIFIPYAGVSMSYDTYLASVVTGLSGLELDISGIHQHPDPQQAIKDADGILIGGGNTFHLLHQLYRYDLVTLIGEQVALGKPYIGWSAGSNVSGLSIRTTNDMPIIEPPSFNALNLVPFQLNPHYSNYQAPGHNGETRAQRLLEFTKVDPLTPVVGIVEGSALWRQGDKLSLLGNQPAYLFCGEQQEIPIPVGSDLSNLLKPSL

pepE

Peptidase E

237 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.83 kDa

MTINALLLSSSRVGDTPYLAHAIPFIKPLTTNAQKWIFIPYAGVSMSYDTYLASVVTGLSELELDISGIHQHPDPQQAIKDADGILIGGGNTFHLLHQLYRYDLVTLIGEQVALGKPYIGWSAGSNVSGLSIRTTNDMPIIEPPSFKALNLVPFQLNPHYSNYQAPGHNGETRAQRLLEFTKVDPLTPVVGIVEGSALWRQGDKLSLLGDQPAYLFCGEQQEIPIPVGSDLSHLLKA

pepE

Peptidase E

237 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.815 kDa

MTINALLLSSSRVGDTPYLAHAIPFIKPLTTNAQKWIFIPYAGVSMSYDTYLASVVTGLSELELDISGIHQHPDPQQAIKDADGILIGGGNTFHLLHQLYRYDLVTLIGEQVALGKPYIGWSAGSNVSGLSIRTTNDMPIIEPPSFNALNLVPFQLNPHYSNYQAPGHNGETRAQRLLEFTKVDPLTPVVGIVEGSALWRQGDKLSLLGDQPAYLFCGEQQEIPIPVGSDLSHLLKA

pepE

Peptidase E

237 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.872 kDa

MTINALLLSSSRVGDTPYLAHAIPFIKPLTTNAQKWIFIPYAGVSMSYDNYLASVVTGLSELELDISGIHQHPDPQQAIKDADGILIGGGNTFHLLHQLYRYDLVTLIGEQVALGKPYIGWSAGSNVSGQSIRTTNDMPIIEPPSFKALNLLPFQLNPHYSNYQAPGHNGETRAQRLLEFTKVDPLTPVVGIVEGSALWRQGDKLSLLGDQPAYLFCGEQQEIPIPVGSDLSHLLKA

pepE

Peptidase E

236 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.957 kDa

MTVNALLLSSSRVGDTPYLSHAIPFIKPLTADAQKWIFIPYAGVSMNYDTYLASVVTGLSELKLDISGIHQHPDPRQALKDADGILIGGGNTFHLLHELYKYDLVQLIREEVLKGKPYIGWSAGSNVSGLSIRTTNDMPIIEPPSFAALNILPFQLNPHYSNYRAPGHNGETRAQRLLEFTRVDPITPVIGIVEGSALWRQGETLSLLGENPAYLFCGEQQEIPIPVGSDLSHLLK

pepE

Peptidase E

236 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.952 kDa

MTINALLLSSSRVGDTPYLAHAIPFIKPLTTQAQKWIFIPYAGVSMSYDTYLASVVMGLAELNLDISGIHQHPDPCQAIKDADGILIGGGNTFHLLHELYRYNLINLIREKVAQGTPYVGWSAGANVSGASIKTTNDMPIIEPPSFDALKIVPFQLNPHYSNYRTPGHNGETRAQRLLEFTKVEPLTPVIAIAEGSALWRRDNTLVLLGENPAYLFCGEQQEMLIPIGSDLSHLLK

pepE

Peptidase E

236 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.925 kDa

MTINALLLSSSRVGDTPYLSHALPFIKPLTANAQKWIFIPYAGVSMSYDTYLASVVAGLSELRLDISGIHQHPDPRQAIKDADGILIGGGNTFHLLHELYKYDLVHLIREEVQNGKPYIGWSAGSNVSGLSIRTTNDMPIIEPPSFTALNIVPFQLNPHYSNYRAPGHNGETRAQRLLEFTRVDPITPVVGIVEGSALWRQGDTLSLLGDNPAYLFCGEQQEIPIPVGSDLSHLLK

pepE

Peptidase E

236 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.958 kDa

MTVNALLLSSSRVGDTPYLSHAIPFIKPLTTNAQKWIFIPYAGVSMSYDTYLASVVAGLSELRLDISGIHQHPDPRQAIKDADGILIGGGNTFHLLHELYKYDLVHLIREEVMNGKPYIGWSAGSNVSGLSIRTTNDMPIIEPPSFTALNIVPFQLNPHYSNYRAPGHNGETRAQRLLEFTRVDPITPVVGIVEGSALWRQGETLSLLGDNPAYLFCGEQQEIPIPVGSDLSHLLK

pepE

Peptidase E

236 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.958 kDa

MTVNALLLSSSRVGDTPYLSHAIPFIKPLTTNAQKWIFIPYAGVSMSYDTYLASVVAGLSELRLDISGIHQHPDPRQAIKDADGILIGGGNTFHLLHELYKYDLVHLIREEVMNGKPYIGWSAGSNVSGLSIRTTNDMPIIEPPSFTALNIVPFQLNPHYSNYRAPGHNGETRAQRLLEFTRVDPITPVVGIVEGSALWRQGETLSLLGDNPAYLFCGEQQEIPIPVGSDLSHLLK

pepE

Peptidase E

236 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.964 kDa

MTINALLLSSSRVGDTPYLAHAIPFIKPLTTQAQKWIFIPYAGVSMSYDNYLASVVMGLAELNLDISGIHQHPDPCQAIKDADGILIGGGNTFHLLHELYRYNLINLIREKVAQGTPYVGWSAGANVSGASIKTTNDMPIIEPPSFDALKIVPFQLNPHYSNYRTPGHNGETRAQRLLEFTKVEPLTPVIAIAEGSALWRRDNTLVLLGKNPAYLFCGEQQEMLIPIGSDLSHLLK

pepE

Peptidase E

235 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

26.018 kDa

MNIRALLLSASRVGDTPYLEHTLPFIAPLTEHARNWVFIPYAGISLGYDVYLEKVREGLRNLNINISGIHEHADPRQAIRDADGIFVGGGNTFHLLHELYRYDLLFVIREQVEAGKPYVGWSAGSNIAGLSIRTTNDMPIIEPPSFTALGLLPFQLNPHYTDYQAPGHNGETRAQRLLEFTMVDPLTPVVGIQEGSALYRQGDKLTLLGDKEAYFFKGSVQKSPIAAGADLSELL

pepE

Peptidase E

235 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.833 kDa

MAINALMLSSSRVGNTPYLEHAIEFIKPLSQNTKKWLFIPYAGVSVSHDAYLSMVQQGLADLSLEITSIHQSEDPKQAIRDADGIFVGGGNTFQLLNMLYQHDVLALIREQVQAGKPYVGWSAGSNITGLSIRTTNDMPIVEPPSFNALNLLPFQLNPHYSNYQAPGHNGETRAQRLLEFTVVDPLTPVIAIQEGTALWRQGDSLRLVGNKEGYLFHGKQQEVPLAAGSDLSSYL

pepE

Peptidase E

234 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

26.125 kDa

MKNMLLMSGSKYKDTAYLVHTLPWLAQFLADYKGKKVAFVPYAGVRRSFDEYETTVKNALQSLELEIVSVHRGKQHRDIIEQADVIAIGGGNTFCLLKQMYEHDLLDAIRAKVNSGTPYFGWSAGANVAGSSIMTTNDMPITYPPSFNALNLFPHQINPHFISGKMQGHNGESREERLEEFLIVNPQSLVYAMPEGTALHIQGEQATVLGAQDILCFSEKMQLDTKAVNSTFNY

pepE

Peptidase E

234 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

26.125 kDa

MKNMLLMSGSKYKDTAYLVHTLPWLAQFLADYKGKKVAFVPYAGVRRSFDEYETTVQNALQSLELEIVSVHRGKQHRDIIEQADVIAIGGGNTFCLLKQMYEHDLLDAIRAKVNSGTPYFGWSAGANVAGSSIMTTNDMPITYPPSFNALNLFPHQINPHFISGKMQGHNGESREERLEEFLIVNPQSLVYAMPEGTALHIQGEQATVLGAQDILCFSEKMQLDTKAVNSTFNY

pepE

Peptidase E

234 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

26.095 kDa

MKNMLLMSGSKYKDTAYLVHTLPWLAQFLADYKGKKVAFVPYAGVRRSFDEYETAVKNALQSLELEIVSVHRGKQHRDIIEQADVIAIGGGNTFCLLKQMYEHDLLDAIRAKVNSGTPYFGWSAGANVAGSSIMTTNDMPITYPPSFNALNLFPHQINPHFISGKMQGHNGESREERLEEFLIVNPQSLVYAMPEGTALHIQGEQATVLGAQDILCFSEKMQLDTKAVNSTFNY

pepE

Peptidase E

234 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

26.153 kDa

MKNMLLLSSSKYKNTGYLEHTLPWLQNFLADYRGKTIAFVPYAGVSRTFDEYEKTVQNALSDLGMNIVSVHHGKQHRDIIEQADVISIGGGNTFCLLKQLYEHNLIDIIREKVNNGTPYFGWSAGANVAGASIMTTNDMPITYPPSFQALQLFPHQINPHFISGKMQGHNGESREERLAEFLLVNPTALVYALPEGSALHIQNEMATVLGENPILCFSENMECGTFDINTTFSY

pepE

Peptidase E

234 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

26.384 kDa

MKNMLLLSSSKYKNTGYLEHTLPWLQNFLADYRGKTIAFVPYAGVRRTFDEYEKTVQNALSYLEMNIVSVHHGKQHRDIIEQADVIAIGGGNTFCLLKQLYEHNLIDIIREKVNNSTPYFGWSAGANVVGASIMTTNDMPITYPPSFQALQLFPHQINPHFISGKMQGHNGESREERLAEFLLVNPTALVYALPEGSALHIQNEMATVLGENPILCFSENMECGTFDINTTFSY

pepE

Peptidase E

234 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

26.058 kDa

MKNMLLMSGSKYQNTDYLVHTLPWLQDFLADYQGKTVAFVPYAGVRQSYDEYELKVQKALAELNVAILSVHRAEKHAEIIEKADVIAIGGGNTFCLLKGMYEHHLLPLIREKVQSGTPYFGWSAGANVAGRSIMTTNDMPITYPPSFDALNLFPHQLNPHFISGKPAGHNGESREERLAEFLIVNPTANVYALPEGTALHIQGQQARVLGQHDVLLFSENMQLATLPVNSVFDY

pepE

Peptidase E

234 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

25.35 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGINVTGIHRVADPLAAIEKAEIIIVGGGNTFQLMKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVPGGPNTTWVFKAGEEAVALEAVIAFNPWPH

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.783 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGINVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.799 kDa

MELLLLSNSTLPGKAWLEHALPLMANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLTPLGINVTGIHRIAAPLEAIEKSEIIIVGGGNTFQLLKESRERGLLAPIADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALGLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.739 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPAIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.783 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGINVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.707 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPVADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELAVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.823 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGINVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERELLAPVADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.737 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPVADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.739 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPAIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.823 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGINVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERELLAPVADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.783 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGINVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.718 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGINVTGIHRVADPLAAIEKAEIVIVGGGNTFQLLKESRERGLLAPVADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQHIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.769 kDa

MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.628 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTEKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.31 kDa

MELLLLSNSTLPGKAWLEHALPLVAEQLHGRRSAVFLPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVADPVAAIADAEVVIVGGGNTFQLLKESRERGLLAPIVAAVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALGLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTVIGLPEGNWIQVSKGQATLGGPNTTYVFNAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.598 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEVGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.56 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLASLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.56 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLASLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.57 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.628 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTEKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

229 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.487 kDa

MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTCDDYTAKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF

pepE

Peptidase E

218 amino acids

Hydrolyzes dipeptides containing N-terminal aspartate residues. May play a role in allowing the cell to use peptide aspartate to spare carbon otherwise required for the synthesis of the aspartate family of amino acids.

Belongs to the peptidase S51 family.

24.42 kDa

MKNMLLLSSSKYKNTGYLEHTIPWLQNFLADYRGKTIAFVPYAGVSRTFDEYEKTVQNALSDLGMNIVSVHRGKQHRDIIEQADVIAIGGGNTFCLLKQLYEHNLIDIIREKVNNGTPYFGWSAGANVAGSSIMTTNDMPITYPPSFQALQLFPHQINPHFISGKMQGHNGESREERLAEFLLVNPTALVYALPEGSALHIQNGMGNRIGRKSYFVLQ