PCNA

Probable DNA polymerase sliding clamp

464 amino acids

Sliding clamp subunit. Responsible for tethering the catalytic subunit of DNA polymerase to DNA during high-speed replication (By similarity).

Belongs to the PCNA family.

52.303 kDa

MSKKTGTKTSKSGSKKSNKDVEKLVDDEDIQDLSDKKNKISQSKNLVKNNKSSKNSKSSKSVKSTKTSTKTSLKKQVKTPPKKQTKTSSKKNKKDESDDDVTDNSDISDDDNTGNSDISDDENDQEEDNDISSDEEETETRQKSSGKKGNVNKDVGSSRKLKTDKNARNDNKVLEIRTTQTGALKQVFERVSGVISDCCLTFMPADKDINNAGDDNEYYEDESTKSSHKQSKTTDRPKNTGGIRIIRLTEDNNTLVKVVLEAANFEYFRCDEPKITVGVDMHTLHSHLKMINDDDPIVIYMKKDIQGSLYIRSLSENNDNSEEREIELFLMDIINPEIPVPKTEFQNRITMKSDKFHLICKHLSQNSTFVEITSINNEILFKGQSEGGKVTMTYKDTGYKKKEKPDQVIQGVYELRNLLGFSKCNKLCNTIEIYLKNDFPLVLVISVATLGKMYVFLSPIDNGN

PCNA

Proliferating cell nuclear antigen

274 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

30.587 kDa

MLEAKLNNASILKKLFECIKDLVNDANVDADESGLKLQALDGNHVSLVSLHLLDSGFSHYRCDRERVLGVNIASLNKVFKLCGANESVVISSKDDEDNLNFVFENNKEDKVTNFSLKLMSIELDSLNIPDCEEGFDAEVELSSKELTNIFRNLSEFSDTVFIEIDSNCIKFTTKGIVGDAEVALKPRDSTSEDDIGVTIKSKKKIKQSFAIKYLNLFSKSNILADVVVLGLSDSRPIEFKYEIKDTSPDSDTLKIGFVKFFLAPKMDDDMDNKD

PCNA

Proliferating cell nuclear antigen

274 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

30.587 kDa

MLEAKLNNASILKKLFECIKDLVNDANVDADESGLKLQALDGNHVSLVSLHLLDSGFSHYRCDRERVLGVNIASLNKVFKLCGANESVVISSKDDEDNLNFVFENNKEDKVTNFSLKLMSIELDSLNIPDCEEGFDAEVELSSKELTNIFRNLSEFSDTVFIEIDSNCIKFTTKGIVGDAEVALKPRDSTSEDDIGVTIKSKKKIKQSFAIKYLNLFSKSNILADVVVLGLSDSRPIEFKYEIKDTSPDSDTLKIGFVKFFLAPKMDDDMDNKD

PCNA

Proliferating cell nuclear antigen

266 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

29.474 kDa

MLELRLVQGSLLKKVLESIKELVNDANFDCSSTGFSLQAMDSSHVALVALLLRSEGFEHYRCDRNLSMGMNLNNMAKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKISDFEMKLMDIDSEHLGIPEAEYHAIVRMPSAEFARICKDLSSIGDTVVIAVSKEGVKFSTKGDIGSANIVCRQNTTVDKPEEATVIEMNEPVALQFALRYMNSFTKATPLSSSVTISLSNELPVVVEYKIAEMGYVRFYLAPKIEEDEEETKPQA

PCNA

Proliferating cell nuclear antigen

264 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

29.139 kDa

MLELRLVQGSLLKKVLESIKDLVNDANFDFSSSGFSLQSMDSSHVALVALLLKSEGFEHYRCDRNTSMGMNLGNMSKMLKCAGNDDIITIKGDDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPEAEYHAIVKMPSAEFARICKDLASIGDTVVISVTKEGVKFSTRGDIGTANIVLRQNTTVDKPEDATVIEMNEPVSMTFALRYMNSFTKATPLSNTVTISMSPDLPVVVEYKIAEMGYVRFYLAPKMEEDEPEPGA

PCNA

Proliferating cell nuclear antigen

264 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

29.26 kDa

MFEARLIQGSNLKKVQEALKDIVTEASWDCTSSGISLQAMDSSHVSLVQLTLRADGFENFRCDRNLAMGINMTSMAKIMKCAGNDDIITLRAEDNADMLELIFESSKGDKYSQYEMKLMDLDCEQLGIPEQDYSCCVTLPSQEFGRICRDLSQIGECVVITCTKDGVQFSAKGDLGAGKIKLKQNTGSDIKEEEQVTVEISEPVQLTFAIKYLNLFAKASPLSPSVCLSMSNNVPLVVEYKVADMGHIKYFLAPKIEDEEEQDS

PCNA

Proliferating cell nuclear antigen

264 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

29.272 kDa

MLELRLVQGSLLKKVLESIKDLVNDANFDCSATGFSLQAMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLANMAKMLKCAGNDDIITLKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPEAEYHAIVRMPSAEFSRICKDLSSIGDTVVISVTKEGVKFSTRGDIGTANIVCRQNTTVDKPEEATVIEMNEPVSLTFALRYLNSFTKATPLSNTVTISLSSELPVVVEYKIAEMGYIRFYLAPKIEEDEEETKP

PCNA

Proliferating cellular nuclear antigen 1

263 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

29.122 kDa

MLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYKVAEMGYIRYYLAPKIEEEEDTNP

PCNA

Proliferating cell nuclear antigen

263 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

29.343 kDa

MLELRLVQGSLLKKVLEAIRELVNDANFDCSGTGFSLQAMDSSHVALVALLLRAEGFEHYRCDRNLSMGMNLNNMAKMLRCAGNDDIITIKADDGSDTVTFMFESPKQDKIADFEMKLMDIDSEHLGIPDSEYQAIVRMPSSEFMRICKDLSSIGDTVVISVTKEGVKFSTSGEIGSANIVCRQNQTIDKPEEATIIEMQEPVSLTFALRYMNSFTKASSLSEQVTISLSSELPVVVEYKIAEMGYIRFYLAPKIEDDEEMKP

PCNA

Proliferating cell nuclear antigen

262 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.888 kDa

MFEARLVQGSVLKRVLEALKDLITEACWDLGSGGISLQSMDSSHVSLVQLTLRSEGFDTYRCDRNIAMGVNLNSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSAEFARICRDLSHIGDAVVISCAKDGVKFSANGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDQQEGS

PCNA

Proliferating cell nuclear antigen

262 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.916 kDa

MFEARLVQGSVLKRVLEALKDLITEACWDLGSGGISLQSMDSSHVSLVQLTLRSEGFDTYRCDRNIAMGVNLNSMSKILKCAGNEDIITLRAEDNADTLALVFETPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSAEFARICRDLSHIGDAVVISCAKDGVKFSANGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHXKYYLAPKIEDQQEGS

PCNA

Proliferating cell nuclear antigen

261 amino acids

Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways. Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (By similarity).

Belongs to the PCNA family.

28.749 kDa

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVAIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Pcna

Proliferating cell nuclear antigen

261 amino acids

Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways. Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (By similarity).

Belongs to the PCNA family.

28.749 kDa

MFEARLIQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVSIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

pcna

Proliferating cell nuclear antigen

261 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.897 kDa

MFEARLVQGSILKKVLEALKDLIDEACWDITSSGISLQSMDSSHVSLVQLTLRSDGFDTYRCDRNQSIGVKMSSMSKILKCAASDDIITLRAEDNADTVTMVFESPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSQIGDAVVISCAKDGVKFSASGELGTGNVKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVILSMSADIPLVVEYKIADMEHVKYYLAPKIEDEEAS

Pcna

Proliferating cell nuclear antigen

261 amino acids

Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways. Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (By similarity).

Belongs to the PCNA family.

28.785 kDa

MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEAS

PCNA

Proliferating cell nuclear antigen

261 amino acids

Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways. Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (By similarity).

Belongs to the PCNA family.

28.795 kDa

MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSTDVPLVVEYKISDMGHLKYYLAPKIEDEEGS

PCNA

Proliferating cell nuclear antigen

261 amino acids

Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways (PubMed:24939902). Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (PubMed:24695737).

Belongs to the PCNA family.

28.769 kDa

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

PCNA

Proliferating cell nuclear antigen

261 amino acids

Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways. Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (By similarity).

Belongs to the PCNA family.

28.769 kDa

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

pcna

Proliferating cell nuclear antigen

260 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.601 kDa

MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRSDGFDSYRCDRNLALGVSLNSMSKMLKCAGNEDIITLRAEDNADTLALVFETLNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVMFSASGELGTGNVKLSQTSNVDEEDDAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIDEEAS

PCNA

Proliferating cell nuclear antigen

260 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

29.036 kDa

MFEARLLRSSILKKVLEAIKDLLTQATFDCDDNGIQLQAMDNSHVSLVSLTLRADGFDKYRCDRNISMGMNLGSMSKILIFAGDKDTATIKAQDNADNVTFVFESPNQEKVSDYEMKLMNLDLEHLGIPETEYSCTIRMPSSEFARICRDLSQFGESMVISCTKEGVKFSATGDIGSANVKLAQTASIDKEEEAVVIEMEEPVTLTFACQYLNYFTKATSLSPQVQLSMSADVPLVVEYRIPDIGHIRYYLAPKIEEEDS

PCNA

Proliferating cell nuclear antigen

260 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.956 kDa

MFEARLINATILKKILDAIKELLHEATFECSESGIQLQAMDNSHVSLGSLTLRSDGFDKFRCDRNISMGMNLGSMAKILKCANNDDTVTVKAQDNADTVTFMFESPNHEKVSDYEMKLMNLDQEHLGIPETDYSCVVRMPSMEFARICRDLAQFSESMLICCTKEGVKFSASGDVGSANVKLAQTSSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSAQVQLSMCADVPLVVEYAIKELGHIRYYLAPKIEDDES

pcna

Proliferating cell nuclear antigen

260 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.611 kDa

MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRSDGFDSYRCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDNADALALVFETLNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNIKLSQTSNVDKEDEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIDEESS

PCNA

Proliferating cell nuclear antigen

260 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.83 kDa

MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLTLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVTIMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDNET

pcna

Proliferating cell nuclear antigen

260 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.689 kDa

MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRHDGFDSYRCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDNADTLALVFETLNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNIKLSQTSNVDKEDEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYKIADMGHIKYYLAPKIDEEAS

pcna

Proliferating cell nuclear antigen

258 amino acids

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.

Belongs to the PCNA family.

28.314 kDa

MFEARLLQASLLKKILESIKDLVESANFDCSPEGISLQAMDGTHVTLINLVLRNEGFETYNCDRSLSLGLSLVSLSKILKCAGNDDTLTIRARDNESDTVTFVFESPKNDRVSDFEIKLIDIKNEQYSIRKSDYSAVIKMPSAELQRICRDLSIIGEIVTISANKEGVKFSVSGDSGSGNITIKPTSDSDVPAEQATVIESKEPVVLNFALKFLSNFTKATPLSPMVTLSMSEGIPVVVEYKIDDLGFLGFFLAPKIE

PCNA

Probable DNA polymerase sliding clamp

256 amino acids

Stimulates the viral DNA replication. The virus utilizes both cellular and viral PCNAs during viral DNA replication in order to produce budded virus (BV). In addition, stimulates the expression of late genes 38K and VP39 by promoting the transcription of IE2.

Belongs to the PCNA family.

28.635 kDa

MFEAEFKTGAVLKRLVETFKDLLPHATFDCDNRGVSMQVMDTSHVALVSLQLHAEGFKKYRCDRNVPLNVSINSLSKIVKCVNERSSVLMKAEDQGDVMAFVFNNDNRICTYTLKLMCIDVEHLGIPDSDYDCVVHMSSVEFAQVCKDMTQFDHDIIVSCSKKGLQFRANGDIGSADVQMSADNENFSVLKAKQTVTHTFAGDYLCHFAKAAPLAPTVTIYMSEELPFKLEYCIKDVGVLACFLAPKIVNNDEEIF

PCNA

Probable DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit. Responsible for tethering the catalytic subunit of DNA polymerase to DNA during high-speed replication (By similarity).

Belongs to the PCNA family.

26.78 kDa

MEATFATAAAFQSIVGALRGLLTHATFDCDAHGMRLHSLDVERVALADLRLRRAGFARYACERKLSFSVPVRGLVKIVRTADPSAPLTMRVAARDDRVRLAYETARRAVSCTLAQISLDADRLGVPDKEYTCVLAVPSAELTRACADLARLGATTVEMSSGTTGLSFAAHADDGVRVRVLLRGSPQRPLTQAFACCYLNKLARASALSETVDVCMDASMPLRLRFRLGPLGALDLYLAPRVPSVGESAQ