pcm2

Protein-L-isoaspartate O-methyltransferase 2

306 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

32.108 kDa

MSTTPPRNKFPLPLDAVVERKPAPARTAGLPAVGTPRPAAPTPAPAKPAKPRLPRTAAPAPAPVPASAVEQRASAATAGGGGMASARARAALAARLRAAGIRDERVLSAIATVPRHLFVEPGLASQAYEDAALPIGHQQTISKPSVVARMIELLREGLAADAPLERVLEIGTGCGYQAAVLSQVAREVFSIERIRPLHEQAKANLRPLRVPNLRLHYGDGMLGLPQAAPFSAIILAAAGMEVPEALLEQLAIGGRLIAPVAVMPPAGVPGQTVTQQLLLIERRNRHRFHRTALEAVFFVPLKSGTI

pcm2

Protein-L-isoaspartate O-methyltransferase 2

247 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

26.797 kDa

MSRKSTGAFLVILLLSMAAGGAVGAADDPYGAARAKMVREIEEDARRTSERIGKTALDPRVMEIMARVPRHEFVPAAERAYAYENRPLPIGYGQTISQPYIVAVMTDLLKVGSESTVLEVGTGSGYQAAILAEFVRSVYSIEIIEALAETAAERLKRLGYDNVRVRTGDGYHGWKEHAPFDGIVVTAAAGHIPPPLLDQLKPGGRMIIPVGGPFFVQQLMLVEKDEQGRTRTRQILPVAFVPLTGGH

pcm2

Protein-L-isoaspartate O-methyltransferase 2

244 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

26.988 kDa

MGKLLFLFITLILFEQQSLAALPTGDSEKYLRARESMVQNQLSTRDIKDKRVLTAMREVPRHLFVPDLLVFKAYTDSPLPIGEGQTISQPYIVALMTELLELTGSERVLEIGTGSGYQAAVLSQVAKEVFTIEIKEKLCTKAGKLLDSLGYTNIQARCGDGYFGWNKEAPFDAIMITAAVDHVPPPLLAQLKDGGRLVLPLGNPFSYQNLVLVTRKGDDYRVWQISGVLFVPMTGHALKDSGEK

pcm2

Protein-L-isoaspartate O-methyltransferase 2

243 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

26.454 kDa

MLARSLLPALALLLAATAGGDACADRGHPSAERSTPETERRRMVEEQLAARGIRDRRVLEAMGKVPRERFVPEQWRSLAYLDEPLPIGRGQTISQPYVVAFMAQALALRGGERVLEVGSGSGYAAAVLAHLAGAVYGIELEPELHARSVETLAELGYGNVHLRRGDGFLGWPERAPFRAIVVSCAMEEIPAPLWEQLVQGGRIVYPKGPEGEVQLLVVVTKTARGPREEHLAPVRFVPMRRGG

pcm2

Protein-L-isoaspartate O-methyltransferase 2

238 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins (By similarity).

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

26.97 kDa

MVLVNAISEKDYIKDSRRRKKEEKEFEKLRKLLVEGLEDIVRDKKVLKAMFRVPRHRFVPEYEQRAAYTDRPLEIGHGQTISTPHTVALMCEILELSEGHKVLEIGTGSGYNAAVMAELVGKTGHIYSVERIEPLVNFARKNLEQMGYDNVTVLLENGSMGYPRYAPYDRIAVTCAAPTIPKALLEQLKPGGIMVIPVGDYSQELIRVKKDSNGNIYKKRKGEVIFVPMLGRHGFPRS

pcm2

Probable protein-L-isoaspartate O-methyltransferase

230 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. This enzyme does not act on D-aspartyl residues (By similarity).

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

25.333 kDa

MFWSFNLSSNAALVQHLVESKFLTNQRAIKAMNATSRSFYCPLSPYMDSPQSIGYGVTISAPHMHATALQELEPVLQPGCSALDIGSGSGYLVAAMARMVAPNGTVKGIEHIPQLVETSKKNLLKDINHDEVLMEMYKEKRLQINVGDGRMGTSEDEKFDAIHVGASASELPQKLVDQLKSPGKILIPIGTYSQNIYLIEKNEQGKISKRTLFPVRYVPLTDSPDDSSDY

pcm2

Protein-L-isoaspartate O-methyltransferase 2

225 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

25.003 kDa

MRYRCPMNCPSLRNQEYRREIMISEQLMGRGIRDPAVLAAMRQVPREAFVDQGMRELAYEDHPLPIDGGQTISQPYIVAYMTEALELSSSDRVLEIGTGSGYAAAVLSRIVHTVYSVERLEELARGARQRLESLGYNNVEVFEGDGTLGWPEHAPYDAIVVTAGAPAVPKPLLRQLVVGGRLVIPVGASSFLQNLIRVRRQGEDDYRSEELCGVRFVPLVGAEGW

pcm2

Protein-L-isoaspartate O-methyltransferase 2

219 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins (By similarity).

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

24.667 kDa

MDYDEKRERLAERLRQELNLSRKVYEAIRKVPRHLFVPESYKNEAYVDTPLPIGYGQTISAPHMVAIMCELLDLREGDKVLEVGTGCGYHAAVTAEIVGKSGKVISIEYIPELAERARAILKALGYDNVEVIVGDGSKGYEKEAPYDKIYVTAAAPDIPKPLIEQLKPRGRMVIPVGDSVQWLIIVEKDESGNVRKKNWGSVRFVPLRGEYGFKSVRYD

pcm2

Protein-L-isoaspartate O-methyltransferase 2

219 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

23.65 kDa

MNKDGQDLSDIRRAMVRCQLVPRGISDGRVLEAMERVPREQFVPEHLRFEAYEDHPVPIGQGQTISQPYIVALMAEALCLKGRERVLDIGTGSGYAAAVLASLALEVFSIERIPELAAQARKNLDRTGFTQVHVKCADGTLGWPEAAPFDGICVAAGAPAVPAALKQQLAVGGRLVIPVGTEGGLQQLLCITRLSDSEYEQASYGDVRFVPLLGEEGWP

pcm2

Protein-L-isoaspartate O-methyltransferase 2

219 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

24.264 kDa

MKSHREMLRGIQREAGITQRWIGKESLDRRVMEAMKAVPRHEFVPDEQRPYAYDDAPLAIGCGQTISQPYIVALMTDLLDSTPDDIILEVGTGSGYQAAVLSRLVKKVYTIETIEELAQQAEARLERLGYSNVEVQTADGYFGWPEQAPFDGIMVTAAAPSIPKPLIDQLKPEARLVLPLGAGSPQELMVVTKKENDEIDIHRVLGVSFVPLTGKHEVP

pcm2

Protein-L-isoaspartate O-methyltransferase 2

217 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

23.637 kDa

MINLDIARRRMVENQIVARGIKDRRVIDAMLKVPRHIFVEEAMSAQAYSDSSLPIGEKQTISQPYMVALMSGMLQLTGKEKVLELGTGSGYQAAILAELADRVYTVERIRPLALRARKALDSLGYLNVNLKIGDGTDGWASEAPFDAILVTAGAPDVPMHLIDQLAVGGKLVIPVGNQSEQTLVRITKGENGAVSREDSIGCRFVKLIGRYGWSGED

pcm2

Protein-L-isoaspartate O-methyltransferase 2

217 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

23.904 kDa

MISSVAPPPEKMLFQLSLRRRGISDRGVLQAMESVPRDRFVDAVHRDSAWRDTALPIACGQTISQPFVVAYMTEQLHLQPGHRVLEIGTGSGYHAAVLSRLVRDVVSVERFKTLADRARARLKELNYANVEVVLGDGFALPEGQGTFDRILVTAAMAELPQPLLDLLDPDGILIAPIGPGNGRQTLIRVQRKDDGFLRKPLVDVRFVPALPGIAREL

pcm2

Protein-L-isoaspartate O-methyltransferase 2

211 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

23.485 kDa

MTSQRTRARMVERLCTQGVTDEAVLTAMITVPRHIFVEEVLASRAYDDVALPINFEQTISNPFTVARMSQLLRAGSNPGKVLEIGTGSGYQTAILAQFSREVYSVERIGPLLTRTRGRLRELRINNVRLKHADGLLGLSEAAPFDGIILTAATPHMPPALLEQLAIRGRMVFPRGTSEQVLCVIERNLQGYTETILDEVKFVPMIPGIWQR

pcm2

Protein-L-isoaspartate O-methyltransferase 2

211 amino acids

Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

23.226 kDa

MMEEITALVRETRTETGKPALDERVMAVMGKVPRHEFVPADQLPRAYQNRPLPIGHGQTISQPYIVALMTDLARVEPGHKVLEVGTGSGYQAAVMAHLARAVYTIEIIEPLGLQARQRLQKLGYDNVQVRLGDGYHGWEEHAPYDAILVTAAASHIPPPLIRQLKAGGRMVIPVGAAFMVQQLMLVEKNRDGTVSTRQILPVAFVPLTGQR

PCM2

Calmodulin-2/4

124 amino acids

Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.

Belongs to the calmodulin family.

13.986 kDa

single

GCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMAK