PCD1

Peroxisomal coenzyme A diphosphatase 1, peroxisomal

340 amino acids

Coenzyme A diphosphatase which mediates the cleavage of CoA into 3',5'-ADP and 4'-phosphopantetheine. Has a strong preference for oxidized CoA disulfide (CoASSCoA) as substrate. May be required to remove potentially toxic oxidized CoA disulfide to maintain the capacity for beta-oxidation of fatty acids. Can degrade 8-oxo-dGTP in vitro; however, such activity may not be relevant in vivo.

Belongs to the Nudix hydrolase family. PCD1 subfamily.

39.755 kDa

MILSQRRMLSSKQLIENLIRYKFHKTPYTRSSIWPFKRNSAVIILLFIGMKGELRVLLTKRSRTLRSFSGDVSFPGGKADYFQETFESVARREAEEEIGLPHDPEVLHKEFGMKLDNLVMDMPCYLSRTFLSVKPMVCFLYKDKLEKHEDKYKVPLDIRKFFGKLNPGETSSLFSVPLNDLVIHLLPEADEDVKSYQAEYFERKEYKLNWGGIKWLIMHYHFHVANNNEMPWLQTIEDLSSSDEDGVDGGIFRFRDLWGLTCKILFDVSCIANGLMDEKLKGELGHEDLIVGLHDYGNQMQPNGRSEWEIGMINGDRNLKYSDVIPEYYMKHLLECRSLW

pcd1

Putative cytidine deaminase

133 amino acids

This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.

Belongs to the cytidine and deoxycytidylate deaminase family.

14.892 kDa

MEKEDIEKLFQEVKKSLQYSYCPYSNFAVGACVVSDDKNTYIYGANVENASYGNCICAERVAITKAVSMGYTKFMAIGVMSAKGRVTPCGICRQVIREFSKDINVYMFHDDGGYDMKTIEELLPDSFGPDDLK