pbsA1

Heme oxygenase 1

240 amino acids

Catalyzes the opening of the heme ring with the release of iron. Key enzyme in the synthesis of the chromophoric part of the photosynthetic antennae.

Belongs to the heme oxygenase family.

27.051 kDa

MSVNLASQLREGTKKSHSMAENVGFVKCFLKGVVEKNSYRKLVGNLYFVYSAMEEEMAKFKDHPILSHIYFPELNRKQSLEQDLQFYYGSNWRQEVKISAAGQAYVDRVRQVAATAPELLVAHSYTRYLGDLSGGQILKKIAQNAMNLHDGGTAFYEFADIDDEKAFKNTYRQAMNDLPIDQATAERIVDEANDAFAMNMKMFNELEGNLIKAIGIMVFNSLTRRRSQGSTEVGLATSEG

pbsA1

Heme oxygenase 1

238 amino acids

Catalyzes the opening of the heme ring with the release of iron. Key enzyme in the synthesis of the chromophoric part of the photosynthetic antennae (By similarity). Upon overexpression in E.coli with PCB:ferredoxin oxidoreductase, CpeS and either CpcB or PecB permits synthesis of phycocyanin-coupled CpcB or PecB.

Belongs to the heme oxygenase family.

26.902 kDa

MSSNLANKLRVGTKKAHTMAENVGFVKCFLKGVVEKSSYRKLVANFYYVYSAMEEEMEKHSQHPIVSKINFSQLNRKQTLEQDLSYYYGANWREQIQLSPAGEAYVQRIREISATEPELLIAHSYTRYLGDLSGGQILKNIAVTAMNLNDGQGTAFYEFADISDEKAFKAKYRQTLDELAIDEATGDRIVDEANAAFGMNMKMFQELEGNLIKAIGMMLFNTLTRKRTRGATELATAE