Function
Required for cytoplasmic partitioning and asymmetric cell division in early embryogenesis (PubMed:10704392). Controls the asymmetric cell division of the Q.p neuroblast lineage (PubMed:23267054). Involved in mediating cell polarization via regulation of anillin family scaffold proteins (PubMed:21276723). Phosphorylates and restricts the asymmetry effectors mex-5 and mex-6 to the anterior cytoplasm of the zygote and maintains these phosphorylations until fertilization (PubMed:18842813). May phosphorylate par-1. Required for strd-1 localization to the cell cortex of early embryos and may be required for strd-1 protein stabilization. May regulate the integrity of the early embryonic cortex in a strd-1-dependent manner (PubMed:20110331). Phosphorylates and regulates aak-2 in response to oxidative stress and during dauer development (PubMed:18408008, PubMed:20110331). May also play a role in motility, behavioral response, regulation of lifespan and dauer formation through this pathway (PubMed:15574588, PubMed:18408008). Required to establish germline stem cell (GSC) quiescence during dauer development (PubMed:20110331). Acts downstream of unc-40 in dendrite outgrowth (PubMed:21186357). May play a role in cell shedding during embryogenesis, probably by phosphorylating pig-1 (PubMed:22801495).
Sequence
MDAPSTSSGAQSKLLMPGDDEADEDHQNRGDPNLQQKQKIQLNVDPDYDDDEDDDCFIDGCEASAPITRELVDGAIERRSKDRNVKMSIGVYDEYDDDDDDEEETEEDQRRRFVEGIRNIRHKQQESFDLEEHPIPVESEAMRQFINQQVNNAMMFNQDNSEFQHIEFEPIVKQKGPKIIEGYMWGGQIGTGSYGKVKECIDMYTLTRRAVKIMKYDKLRKITNGWENIRSEMSILRRMNHRNVIKLIEIFNIPAKGKVYMVFEYCIGSVQQLLDMEPARRLTIGESHAIFIELCQGLNYLHSKRVSHKDIKPGNLLVSIDFTVKICDFGVAEQINLFQRDGRCTKVNGTPKFQPPECIYGNHDFFDGYKADMWSAGVTLYNLVSGKYPFEKPVLLKLYECIGTEPLQMPTNVQLTKDLQDLLTKLLEKDFNERPTCLETMIHPWFLSTFPEDQGLGRIMERMRTGDRPLTMLSSMTALYDGITPEDELIIEDNLGIIQQILPINLTSEAVLERGSFPGFKFLEAKPGDGPDGVEGSEDSAAPLGPQRRPSSRSMPTCAPPGPAAGNAQNSTAENGAETDGVASASDPPPTAAPGAPPRRRKRNFFSCIFRSRTDSA