PAPI

Tudor and KH domain-containing protein homolog

629 amino acids

Participates in the primary piRNA biogenesis pathway and is required during spermatogenesis to repress transposable elements and prevent their mobilization, which is essential for the germline integrity (PubMed:23970546, PubMed:26919431). The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins (Siwi or Ago3) and govern the methylation and subsequent repression of transposons (PubMed:23970546, PubMed:26919431). Required for the final steps of primary piRNA biogenesis by participating in the processing of 31-37 nt intermediates into mature piRNAs: acts by recruiting the exonuclease PNLDC1/trimmer to Siwi-bound pre-piRNAs (PubMed:26919431).

Belongs to the Tdrkh family.

69.543 kDa

MSLNTKLALPIALGLSLVTVTAFVAYYVLKRDEEENDNKTVKITKINTIEIHVPKSIVPALIGRNGSNIKDLQKKSGAQIHFKKFTDQDYDVCVVRGRADTTQLAETLIHDFIKQQPTIMSESITVPSWSCGRIIGSGGENVNDISHRSGARVKVESPKSTDKVAEHLVTFRGTKEQIEVAKKLVENCVSLERCRREIEQSKRPPRHSSSPPSPCPSPGDRDADADAQGDVDHTRVKYKRPETTGPSIEVYVSAVSSPSRFWVQFVGPQVAQLDDLVAHMTEYYSKKENREAHTLRHVSVGQVVAAVFRHDGRWYRARVHDIRPNEFDSSQQVADVFYLDYGDSEYVATHELCELRADLLRLRFQAMECFLAGVRPASGEEAVSPSGQTWDKWHPQAVERFEELTQVARWKALVSRTCTYKKTATAEGEKDKEIPGIKLFDVTDEGELDVGAVLVAEGWAVAGPAPSPRPSPPRGHTTPFGDLSKSKVLSMTGGGGRSSSVPKDHKDDGSNVLTVEGDDSKDKDGITASKSLASGLEKSDRHPLSISNFDLSYPDPSRNKQLNGSDDFLHGERQNIDNEITIDTLVPPSPLSNAPILSKTLQDEFKANMNRIDSHHSNLENLGKSAFEK

papi

Tudor and KH domain-containing protein homolog

576 amino acids

Involved in the piwi-interacting RNA (piRNA) metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins, and governs the methylation and subsequent repression of transposons which is essential for germline integrity (PubMed:21447556, PubMed:29531043). Likely to act by recruiting Piwi proteins such as AGO3 and piwi to the piRNA biogenesis machinery in the nuage (PubMed:21447556, PubMed:29531043). Required for the final steps of primary piRNA biogenesis by participating in the 3' end-trimming of piwi-bound intermediates into mature piRNAs (PubMed:29531043).

Belongs to the Tdrkh family.

63.823 kDa

MLRNTPFGATPTYKLLLGFGLCSLGGAMLYAYFKTRNDEEEADSGGQRPASGIRGQTEEQKPQKEVCLKIVVDNEHVPLIMGRGGSNIKLIEEKTLAKIRLRDKDSGHKFCDISGVPDAVKAARALLIKEIERAPVVKVELQVPQRLASKINGRGGELLQEIRSSSLAKLNIDLNGRNGKAKITIIGNQKQVNIARKMLDDQIEEDEELVRSMEEVEQRREPRRSPTNSIASSMYSSQTSLSSHTQPRDKLMASKGEGKPMEVYVSAVASPTKFWVQLIGPQSKKLDSMVQEMTSYYSSAENRAKHVLTAPYVGQIVAAVFKFDEKWYRAEIVDIMPNQYNPKEQVIDLYFVDYGDSEYISPADICELRTDFLTLRFQAVECFLANVKSTIQTEPITWPKSSIAKFEELTEVAHWRKLIARVVTYKERPRATTAVSAAAKEGTPLPGVELFDPADNSELNIADLMITQGFALPLDDSYPVRSRSSTPSSNSDSTIEELCVSNPVTPLTPHSPMSMSIDVDSITQAENEHLAQQLQHLQHKLNGNDIKNINPAKLTATDLENGNNNNASTTNGASAH

papI

Major pilus subunit operon regulatory protein

77 amino acids

Plays a role in the inhibition of methylation at the GATC1028 site located in the regulatory region upstream of the pabA promoter. May, in conjunction with the Mbf (methylation blocking factor), inhibits deoxyadenosine methylase from methylating the GATC1028 site.

To E.coli AfaF and DaaF.

8.855 kDa

MSEYMKNEILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKEGMVQRSPLRRGMATYWFLKGEMQAGQNCSSTT