papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

423 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

45.595 kDa

MFAGSVIRKLSHSEEVFARYEVFTSMTIQLRGVLDIDALSEAFDALVQAHPVLASHLETSSDGGWNLVADDLLHPGICVVDANNGAQSGCGGIQSETRLDQSVSLLNLRLTPREGGGELVLYIHHSMADGHHGAVLVDELFSRYTDVVTTGDPGPIIPQATPLSMEAVLQQRGVKKHALSGAERFMSVMYAYDLPATGTPAVLAEPGLPQAVPVTRLWLTKQETSDLAAFGREHRLSINAVVAAAILMTEWRLRETPHVPIPYVYPVDLRYVLAPPVAPTESTNLLGAAGYLAEIGQDTDIVDLATDIVATLRADLANGVVQQSGLHFGTAFEGTPPGLPPLVFCTDATAFPTMRTPPDLAIEDIQGRFYCSISVPLDLYSCGVYEGQLIIEHHGHIEEPAKALEAIRSLLCTVPSEYGWIME

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

422 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

45.429 kDa

MFPGSVIRKLSHSEEVFAQYEVFTSMTIQLRGVIDVDALSDAFDALLETHPVLASHLEQSSDGGWNLVADDLLHSGICVIDGTAATNGSPSGNAELRLDQSVSLLHLQLILREGGAELTLYLHHCMADGHHGAVLVDELFSRYTDAVTTGDPGPITPQPTPLSMEAVLAQRGIRKQGLSGAERFMSVMYAYEIPATETPAVLAHPGLPQAVPVTRLWLSKQQTSDLMAFGREHRLSLNAVVAAAILLTEWQLRNTPHVPIPYVYPVDLRFVLAPPVAPTEATNLLGAASYLAEIGPNTDIVDLASDIVATLRADLANGVIQQSGLHFGTAFEGTPPGLPPLVFCTDATSFPTMRTPPGLEIEDIKGQFYCSISVPLDLYSCAVYAGQLIIEHHGHIAEPGKSLEAIRSLLCTVPSEYGWIME

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

422 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

45.429 kDa

MFPGSVIRKLSHSEEVFAQYEVFTSMTIQLRGVIDVDALSDAFDALLETHPVLASHLEQSSDGGWNLVADDLLHSGICVIDGTAATNGSPSGNAELRLDQSVSLLHLQLILREGGAELTLYLHHCMADGHHGAVLVDELFSRYTDAVTTGDPGPITPQPTPLSMEAVLAQRGIRKQGLSGAERFMSVMYAYEIPATETPAVLAHPGLPQAVPVTRLWLSKQQTSDLMAFGREHRLSLNAVVAAAILLTEWQLRNTPHVPIPYVYPVDLRFVLAPPVAPTEATNLLGAASYLAEIGPNTDIVDLASDIVATLRADLANGVIQQSGLHFGTAFEGTPPGLPPLVFCTDATSFPTMRTPPGLEIEDIKGQFYCSISVPLDLYSCAVYAGQLIIEHHGHIAEPGKSLEAIRSLLCTVPSEYGWIME

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

422 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

45.429 kDa

MFPGSVIRKLSHSEEVFAQYEVFTSMTIQLRGVIDVDALSDAFDALLETHPVLASHLEQSSDGGWNLVADDLLHSGICVIDGTAATNGSPSGNAELRLDQSVSLLHLQLILREGGAELTLYLHHCMADGHHGAVLVDELFSRYTDAVTTGDPGPITPQPTPLSMEAVLAQRGIRKQGLSGAERFMSVMYAYEIPATETPAVLAHPGLPQAVPVTRLWLSKQQTSDLMAFGREHRLSLNAVVAAAILLTEWQLRNTPHVPIPYVYPVDLRFVLAPPVAPTEATNLLGAASYLAEIGPNTDIVDLASDIVATLRADLANGVIQQSGLHFGTAFEGTPPGLPPLVFCTDATSFPTMRTPPGLEIEDIKGQFYCSISVPLDLYSCAVYAGQLIIEHHGHIAEPGKSLEAIRSLLCTVPSEYGWIME

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

422 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

45.429 kDa

MFPGSVIRKLSHSEEVFAQYEVFTSMTIQLRGVIDVDALSDAFDALLETHPVLASHLEQSSDGGWNLVADDLLHSGICVIDGTAATNGSPSGNAELRLDQSVSLLHLQLILREGGAELTLYLHHCMADGHHGAVLVDELFSRYTDAVTTGDPGPITPQPTPLSMEAVLAQRGIRKQGLSGAERFMSVMYAYEIPATETPAVLAHPGLPQAVPVTRLWLSKQQTSDLMAFGREHRLSLNAVVAAAILLTEWQLRNTPHVPIPYVYPVDLRFVLAPPVAPTEATNLLGAASYLAEIGPNTDIVDLASDIVATLRADLANGVIQQSGLHFGTAFEGTPPGLPPLVFCTDATSFPTMRTPPGLEIEDIKGQFYCSISVPLDLYSCAVYAGQLIIEHHGHIAEPGKSLEAIRSLLCTVPSEYGWIME

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

422 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols. Is also able to catalyze acyl transfer using various nucleophiles as acceptors and several acyl-CoA thioesters as donors in vitro; preference is observed for saturated medium chain alcohols and long chain acyl-CoA thioesters.

Belongs to the acyltransferase PapA5 family.

45.429 kDa

MFPGSVIRKLSHSEEVFAQYEVFTSMTIQLRGVIDVDALSDAFDALLETHPVLASHLEQSSDGGWNLVADDLLHSGICVIDGTAATNGSPSGNAELRLDQSVSLLHLQLILREGGAELTLYLHHCMADGHHGAVLVDELFSRYTDAVTTGDPGPITPQPTPLSMEAVLAQRGIRKQGLSGAERFMSVMYAYEIPATETPAVLAHPGLPQAVPVTRLWLSKQQTSDLMAFGREHRLSLNAVVAAAILLTEWQLRNTPHVPIPYVYPVDLRFVLAPPVAPTEATNLLGAASYLAEIGPNTDIVDLASDIVATLRADLANGVIQQSGLHFGTAFEGTPPGLPPLVFCTDATSFPTMRTPPGLEIEDIKGQFYCSISVPLDLYSCAVYAGQLIIEHHGHIAEPGKSLEAIRSLLCTVPSEYGWIME

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

416 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

45.667 kDa

MFPSSGIRKLARSEEMFAETHNFIGLAAHVKGSMDADALSDAFDLLLQAHPVLGGHLEQLPDGKWEIVLDDLMHPGIEVVELTGDEPAPPLIFDQTVSLVHLRLTIRDGQAQPTLYIHHSLADGHHQFSLVEELFSTYTDLVTTGTTKPVEVHPAPEPLEVILANRGVEKRTRSGLERLLAAMFVYDLPPSRRAPSDVNPVLPQLVPMAYCTLSEQDTEKIIAFCRANKLGLNSLLSAAVLMAEWNVRRTPNIPVPYVYPVDLRYLLSPPVSATESTNPVGIATYLAEIEKGTDIAELARDINDTYKKDIAEGVIQQSFLHFSPQYVGNPPGLPDVVMFTDNGIVPPLRTPPDMEVAASHGEFYFAVGAGIEIYTSKIFNGQLMIEYHSHGPDREKSVAAIEEQLRAVVARQSGVG

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

414 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

45.394 kDa

MFPGAVIRKLAFSEEIYARYQAFTSFTAHVRGPVDIDAMSEAFDALLQAHPVFAAHLEEGPDGNHHIVANDLLHSGLVVIDGRRAENPHVQLDQRDSLFRLQLTLGESENLVTAYVHHSLADAHHLGSLLDELLSRYTDVVTTGDPGPITPEPAPQPAEDLLKRRGIKQSALTGFERFLPLLFAYDLPPIAEEMRKFEAPEPVPVTRCRLTSQETADLVSFSRDNGLSFNAVLAAAILLAEWRLRETPHVPIPYCYAVDLRFLLSPPVGATESTNPVGLATYLAEIGPDTDITELAADIVATFRADLSDGMIHQSALRSGRILEGTPPGLPPFILCTNVSTLPPIRTPEDVELVDFHSRIHCAMDVPFGFYACSIATDRLSIELHGSIPAPQLLLDAIRDILCSVPSEYGLFME

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

410 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

44.501 kDa

MAYSTSVIRRLAPSEKFFAETQTFTSITVLLDGTVDIDAMADAFDALLEAYPVYAGHLEPDSDGGFELVADDLLHPGLWVQFEGDPAPTDQLDQGVALIYLLVKPDSTPVEVTLFIHHSLADGTHMAGLLFELFARYTEVVTTGSAGPVSPNPAPEPIETVLEQRGIRKQQRSGLDRFIPAMFAYELPPKRVTTRSAAERPAAVPTTRCRLSKAETSSLVKYGRVNRLFVNNLISAAILLAEWQVRRTPHIPIPYVYNVNLRALVEPPVSATGCTLAIGVATYLAHITPQTTMVELARGIADMFQADLADGVVQQSLLHFNMQYEGAIPGLPDVVLSTNLGNAVAMSTPPGLEVVGVQSQFYRASSAVIDVYSFGVVGGELLIEHHVDAAETTIDLIRSLLRSVVSEHQH

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

410 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

44.501 kDa

MAYSTSVIRRLAPSEKFFAETQTFTSITVLLDGTVDIDAMADAFDALLEAYPVYAGHLEPDSDGGFELVADDLLHPGLWVQFEGDPAPTDQLDQGVALIYLLVKPDSTPVEVTLFIHHSLADGTHMAGLLFELFARYTEVVTTGSAGPVSPNPAPEPIETVLEQRGIRKQQRSGLDRFIPAMFAYELPPKRVTTRSAAERPAAVPTTRCRLSKAETSSLVKYGRVNRLFVNNLISAAILLAEWQVRRTPHIPIPYVYNVNLRALVEPPVSATGCTLAIGVATYLAHITPQTTMVELARGIADMFQADLADGVVQQSLLHFNMQYEGAIPGLPDVVLSTNLGNAVAMSTPPGLEVVGVQSQFYRASSAVIDVYSFGVVGGELLIEHHVDAAETTIDLIRSLLRSVVSEHQH

papA5

Phthiocerol/phthiodiolone dimycocerosyl transferase

410 amino acids

Catalyzes diesterification of phthiocerol, phthiodiolone, and phenolphthiocerol with mycocerosic acids, the final step in the phthiocerol, phthiodiolone and phenolphthiocerol dimycocerosate esters (PDIM) synthesis. Can directly transfer the mycocerosate bound to the mycocerosic acid synthase (mas) onto the substrate alcohols.

Belongs to the acyltransferase PapA5 family.

44.501 kDa

MAYSTSVIRRLAPSEKFFAETQTFTSITVLLDGTVDIDAMADAFDALLEAYPVYAGHLEPDSDGGFELVADDLLHPGLWVQFEGDPAPTDQLDQGVALIYLLVKPDSTPVEVTLFIHHSLADGTHMAGLLFELFARYTEVVTTGSAGPVSPNPAPEPIETVLEQRGIRKQQRSGLDRFIPAMFAYELPPKRVTTRSAAERPAAVPTTRCRLSKAETSSLVKYGRVNRLFVNNLISAAILLAEWQVRRTPHIPIPYVYNVNLRALVEPPVSATGCTLAIGVATYLAHITPQTTMVELARGIADMFQADLADGVVQQSLLHFNMQYEGAIPGLPDVVLSTNLGNAVAMSTPPGLEVVGVQSQFYRASSAVIDVYSFGVVGGELLIEHHVDAAETTIDLIRSLLRSVVSEHQH