PAL-1

Phenylalanine ammonia-lyase 1

720 amino acids

This is a key enzyme of plant metabolism catalyzing the first reaction in the biosynthesis from L-phenylalanine of a wide variety of natural products based on the phenylpropane skeleton.

Belongs to the PAL/histidase family.

78.618 kDa

MAPSIAQNGHVNGEVEEVLWKKSIHDPLNWEMAVDSLRGSHLDEVKKMVDEFRKPIVKLWGETLTVAQVASIANADNKTSGFKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFCATSHRRTKNGGALQKELIKFLNAGVFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGSKLDADEAFRVAAVSGGFFELQPKEGLALVNGTAVGSGMASIVLYDSNILAVMFEVLSAIFAEVMNGKPEFTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRAATKMIEREINSVNDNPLIDVSRNKAIHGGNFQGTPIGVSMDNTRLALASIGKLMFAQFSELVNDYYNNGLPSNLTAGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKSVVKNTVSQVAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECRSYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQINDPLLECLKSWNGAPLPIC

pal-1

Homeobox protein pal-1

271 amino acids

Transcriptional activator. Interacts with promoter regions for tbx-8.9, tbx-9, elt-1, hnd-1, scrt-1, and vab-7 genes. Binds the sequence ATTTATGAC. Binds to the enhancer region of the hlh-1 gene promoter during embryonic body wall muscle development. Activates the gene for mab-5 in embryo development. Necessary for vab-7 expression in C blastomeres in the posterior of embryos. Required for posterior V6 neuroectoblast cell fate specification during postembryonic neurogenesis (patterning) which generates the characteristic ray lineage during male tail development. Binds to ced-3 promoter and activated expression which is crucial for tail-spike cell death. Has a role in E cell specification in endoderm development and body wall muscle development (By similarity).

Belongs to the Caudal homeobox family.

30.296 kDa

MSVDVKSEFSENDSSSSSSSPTNVNNVAWPNYQMMPFMNAQPLRDKMLQPSFDPQLYGRWPQMGEAGFYGHSDIYSTFALPQLSTNGQILPTAEVVEVKPPLSNGSSSSDSGMYPSPNDLTPFPSTSSGIGASSSSSDLQAAAAAAANYQMRAATCYQQSVWPFMDYQQPFPWKMPLGSAGKERRASSDTKSLPTGPGTNNVRVRTADKYRMVYSDYQRLELEKEFHTSAFITSDRKSQLSTMLSLTERQIKIWFQNRRAKDRRDKQKIRL

pal-1

Homeobox protein pal-1

270 amino acids

Transcriptional activator. Interacts with promoter regions for tbx-8.9, tbx-9, elt-1, hnd-1, scrt-1, and vab-7 genes. Binds the sequence ATTTATGAC. Binds to the enhancer region of the hlh-1 gene promoter during embryonic body wall muscle development. Activates the gene for mab-5 in embryo development. Necessary for vab-7 expression in C blastomeres in the posterior of embryos. Required for posterior V6 neuroectoblast cell fate specification during postembryonic neurogenesis (patterning) which generates the characteristic ray lineage during male tail development. Binds to ced-3 promoter and activated expression which is crucial for tail-spike cell death. Has a role in E cell specification in endoderm development and body wall muscle development.

Belongs to the Caudal homeobox family.

30.334 kDa

MSVDVKSDFSENESSSTPSPTTVPADVTWPHYPMMPFMQPHPLREKMLQPTFDPQIYGRWSQMGDTGFYGHPDLYPFGLPQLAANGQIPAVEAVDVKPPLSNGSSSSDSGMYPSPSDMMTPFPSTSSGAASSSELSAAAAAAANYQMRAATCYQQSVWPFMDYQQFQGFSWKMPLGNNHGKDRRSSSDGKTLPTGPGTNNVRVRTADKYRMVYSDYQRLELEKEFHTSPFITSDRKSQLSTMLSLTERQIKIWFQNRRAKDRRDKQKIRL