otx2

Homeobox protein OTX2

289 amino acids

May play a role in very early embryogenesis, gastrulation, and the development and subdivision of the diencephalon and the midbrain.

Belongs to the paired homeobox family. Bicoid subfamily.

31.594 kDa

MMSYLKQPPYTVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREASSESGASGQFTPPSSTSVPAISTTTAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLTGPGSTLSPMSSNAVTSHLNQSPASLPTQGYGASGLGFNSTADCLDYKDQASSWKLNFNADCLDYKDQTSSWKFQVL

OTX2

Homeobox protein OTX2

289 amino acids

Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Belongs to the paired homeobox family. Bicoid subfamily.

31.636 kDa

MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Otx2

Homeobox protein OTX2

289 amino acids

Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Belongs to the paired homeobox family. Bicoid subfamily.

31.622 kDa

MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

otx2

Homeobox protein OTX2

289 amino acids

May play a central role in the initial events of axis formation and in particular in specifying anterior head regions and their spatial relationship with trunk structures. Activates the head organizer gene cer1 by acting synergistically with siamois and mix-A/mix.1 through the 5'-TAATCT-3' element of the cer1 promoter. Also binds as a complex with lhx1/lim1 and ldb1 to the gsc promoter to stimulate expression (By similarity).

Belongs to the paired homeobox family. Bicoid subfamily.

31.596 kDa

MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPSKKKPSPAREVSSESGTSGQFSPPCSTSVPVISSSTAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLSGAGATLSPMGTNAVTSHLNQSPAALSSQAYGASSLGFNSTADCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Otx2

Homeobox protein OTX2

70 amino acids

Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Belongs to the paired homeobox family. Bicoid subfamily.

7.139 kDa

single

MTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGAS