ost5

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5

94 amino acids

Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.

Belongs to the OST5 family.

10.947 kDa

MSLNELIVAALKLFFYNKEQKSDCIFFCQVQIVIQISSSMFSLVIRRIHIRKLWYITVFTINASMFSGFFNNPSLLTPNENLLFQVGLHYSFAV

OST5

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5

86 amino acids

Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.

Belongs to the OST5 family.

9.517 kDa

MTYEQLYKEFHSSKSFQPFIHLDTQPKFAICGLIVTLAVLSSALFAVGSKSSYIKKLFFYTILSVIGSLFAGLTTVFASNSFGVYV