ORC2

Origin recognition complex subunit 2

620 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. It has a role in both chromosomal replication and mating type transcriptional silencing. Binds to the ARS consensus sequence (ACS) of origins of replication.

Belongs to the ORC2 family.

71.238 kDa

MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL

Orc2

Origin recognition complex subunit 2

618 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.

Belongs to the ORC2 family.

68.996 kDa

MSASNKGGYKTPRKENLMSIENLTNSEEESEDLNTAMVGNAVESQPKVTSRRSTRRPSPTKKYQAYQKESNGKGQEERIVVNYVEMSDERSSDAEDQEEEESIEESENAARPAAKDLHLIQSEYNVAGTSMFGFNTPKKRDAMALAALNATPCTPKTPKTPRLGVKTPDTKRKKSMDQPKTPAHVRTRVKKQIAKIVADSDEDFSGDESDFRPSDEESSSSSSSSDAGNSSDNDAADDEPKTPSRARRAIVVPVLPKTPSAARLRQSARAKKSNEFVPESDGYFHSHASSKILTSDHTLDRLKNPRLAADRVFSLLSEIKTSAEHEGSINAIMEEYRSYFPKWMCILNEGFNILLYGLGSKHQLLQSFHREVLHKQTVLVVNGFFPSLTIKDMLDSITSDILDAGISPANPHEAVDMIEEEFALIPETHLFLIVHNLDGAMLRNVKAQAILSRLARIPNIHLLASIDHINTPLLWDQGKLCSFNFSWWDCTTMLPYTNETAFENSLLVQNSGELALSSMRSVFSSLTTNSRGIYMLIVKYQLKNKGNATYQGMPFRDLYSSCREAFLVSSDLALRAQLTEFLDHKLVKSKRSVDGSEQLTIPIDGALLQQFLEEQEKK

ORC2

Origin recognition complex subunit 2

577 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K20me3 and H4K27me3. Stabilizes LRWD1, by protecting it from ubiquitin-mediated proteasomal degradation. Also stabilizes ORC3 (By similarity).

Belongs to the ORC2 family.

66.263 kDa

MTSTLELKADKMLKVQFVGDDDVLNHILDREGGPKIKKERAQLLVNTQKIIKKPENELEEDDQEVLKDHNYVEVLGQDVQESLKNGSATDGGNKVYPFQNRKHPEKMAKLASELAKTPRKSVLLNMKNDPKITIDIPQCSKGHSSSDKSQLKNNDKSEFLSTAPRGLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEYEEDTNEDILSQKIQAQNREVSAPVFRETPSKKMKREKTSHLVEKYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLHNLLSKVSPSFSAELKQLNQQHEQLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDCIHIVINGFFPGISVKSVLNSVTEVLDHVGTFRSVLDQLEWITNKFKEDSSLELFLLIHNLDSQMLRGDKSQQIIGQLSSLRNIYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSHYTEETSYENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLCFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGILTDFLENEEEEL

ORC2

Origin recognition complex subunit 2

577 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K20me3 and H4K27me3. Stabilizes LRWD1, by protecting it from ubiquitin-mediated proteasomal degradation. Also stabilizes ORC3.

Belongs to the ORC2 family.

65.972 kDa

MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA

Orc2

Origin recognition complex subunit 2

576 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity). Binds histone H3 and H4 trimethylation marks H3K9me3, H3K20me3 and H4K27me3. Stabilizes LRWD1, by protecting it from ubiquitin-mediated proteasomal degradation. Also stabilizes ORC3 (By similarity).

Belongs to the ORC2 family.

65.893 kDa

MSTLQLKETKVPSVQFVGDDDVLSHILDREGGTKLKKEKAQLLVNPQKVIKKADCELEKSDLEVLEDQNYVKVLGRNIQESLGNGSAKDGRNKVYSFQQRKHPEEMTKLALELAKTSGKKDPLDSNDPEITKNIAQKSKGHSTSEKAPLVNNNKTEFLSTQPHNLRKRIIASRSHYDSESEYSASSSEDDEEATKDEEEDTNVARLSQKSQGQNRLLPAPVSKETLPKKKKRDKASDLVEEYFEAHSSSKVLTSDRTLQRLRRARVDQKTLHNLLRKFVPSFSAEIERLNQQHEKLFHKWMLQLHLGFNIVLYGLGSKRDLLEKFRTTMLQDSIHVVINGYFPGVSVKSILNSITEDVLSHVGTFQSVLDQRDWIINRFKEDSSLELFLLIHNLDSQMLRGDNSQQILGQLSSLHNVYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLMKFQLDNQDSPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDSGILADFLEKEEEEA

Orc2

Origin recognition complex subunit 2

576 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity). Binds histone H3 and H4 trimethylation marks H3K9me3, H3K20me3 and H4K27me3. Stabilizes LRWD1, by protecting it from ubiquitin-mediated proteasomal degradation. Also stabilizes ORC3 (By similarity).

Belongs to the ORC2 family.

65.85 kDa

MSTLRLKEAKVPSVQFVGDDDVLSHILDREGGTKLKKEKVQLLVNPQKVIKKAECELEKSDLEVLEDQNYVEVLGRNIQESLGNGSAVDGRNKVYSFQHRKHPEEMTKLALELAKTSGKIDPLASNDPKITKNIARKSKGHSSEKAPLENNNKNEFPSIQPHNVRKRLIASRSHCDSESEYSASSSEDDEEVAKDDEEDTNVVRCSKKSQGQNRLLPAPVSKEILPKKRKRDKAGDLVEEYFEAHSSSKVLTSDRTLQKLRRARVDQKTLRNLLSKFVPSFSTEIGQLNQQHERLFDKWILQLRLGFNIVLYGLGSKRDLLEKFRTTMLQDSIHVVINGFFPGISVKSILNSITEDVLSHMGTFQSVLDQRDWIMNRFKEDSSLELFLLIHNLDSQMLRGDNSQQILGQLSSLRNVYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLMKYQLDNQDCPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDSGTLADFLEKEEEEES

orc2

Origin recognition complex subunit 2

558 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.

Belongs to the ORC2 family.

62.927 kDa

MSHEAHNGTKLFKVQFTPDEEVLEHITDKQGVTPQSNTAAQRIVAVKNIIKNDDLHVDEATPESWREQNYVDVLGVDTEDTLQNGPGTGGGDVYSFYTIKRSNKMAQLATEMARTPAKTVSFSVSDNPEEAVSPPANKQTENKTPSKGRKNEFISTTPHRLRKRLSAPSQPSDSESDYSASNSDEELEEKSSAAKTPSKVSQTPGKTPSKKGKKNTASNLVEEYFEAHSSSKVLTSDRTLQRLQTPKLDQETLRKLLDQTPSAFADELHRISKKHEALFYKWMLQLHLGFNIILFGLGSKQSLIEKFRTSLLQDSLHIVINEFFPSITAKSILNSITEEALGHPGAFRSPLDQMDFILQRFKDDPSLELYLLIHNLDSQMLRGEKCQQVLGQLASIPNLHLLASVDHINAPLMWDQSKQSLYNWLWYETTTFGSYIEETSYENSLLVKRSGALALSSLTHVLRSLTPNARGIFRLLAEYQMANKDNPSYTGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGMDGVEYLLIPLDLGTLTDFLEMEDKDT

orc2

Origin recognition complex subunit 2

535 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. It has a role in both chromosomal replication and mating type transcriptional silencing. ORC binds to multiple sites within the ars1 origin of DNA replication in an ATP-independent manner.

Belongs to the ORC2 family.

61.023 kDa

MLINEHVRERYHFLRVSLTRVAHLVFANSHESNDLKMVENVSSTPKKGVLEDPSTLTPEVVTPRTPGHRIIKAKGAYTKDRSAKRRRGRIEIERHLLGEFDDNVGSNSLLDVPLYSLEAEPLSPSVMLEDESMEGINQSPQGISVEKLGKEDNRSRSSTPASPSLESHEFSESREAGLSQSNGFEARSHGTGFDEYFDKFSQRKTSSNTLSQLPVLDNQVYLDTVKEICTETEQHTQTLVHFQSRNFHQWYFELVNNFNLLFYGFGSKEHFLSSFVEKKLPCFPIFVVKGYFPQLQLKNVLSSFLEFLEVTPAASVSDMLIQSLSIINSPSFSLGKIVFLVHNIDGESLIDERFQSALAAIASSKNVYFIASVDHVNFALLWDTSLESSFNFVMHDATTFARYYNETTYENSLGIGRANVSNKEKAIKHVLYSLPANSRGIFKFLLIHQLERMMDTQDFDARQGEKVGIEYRSFFQKCSAEFLCSNEPNFRSQLTEFFDHNIIESKRDVSNSEILWVPYPKNLLEILLEDMMEDV

orc2

ORC1-type DNA replication protein 2

410 amino acids

Involved in regulation of DNA replication (By similarity). Binds DNA.

Belongs to the CDC6/cdc18 family.

46.005 kDa

MLRHGLFKDRRVFDENYIPPELRVRRGEAEALARIYLNRLLSGAGLSDVNMIYGSIGRVGIGKTTLAKFTVKRVSEAAAKEGLTVKQAYVNAFNAPNLYTILSLIVRQTGYPIQVRGAPALDILKALVDNLYVENHYLLVILDEFQSMLSSPRIAAEDLYTLLRVHEEIPSRDGVNRIGFLLVASDVRALSYMREKIPQVESQIGFKLHLPAYKSRELYTILEQRAELGLRDTVWEPRHLELISDVYGEDKGGDGSARRAIVALKMACEMAEAMGRDSLSEDLVRKAVSENEAASIQTHELEALSIHELIILRLIAEATLGGMEWINAGLLRQRYEDASLTMYNVKPRGYTQYHIYLKHLTSLGLVDAKPSGRGMRGRTTLFRLAPHLPADRLIEVVDNIIQAKMASGYE

ORC2

Origin of replication complex subunit 2

379 amino acids

Essential protein (By similarity). Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity).

Belongs to the ORC2 family.

42.59 kDa

MALRGGHAAAAAGVSSGSEDDDEEAGFSRSYFLAKEKEPSSGKKRARAAGKLSDLNLVDEQVLRASLAEIPPKHEREVEALTRSYKEQYRNWLFELRCGFGLLMYGFGSKKMLLEDFASTTLSDFTVIVVNGYLPSINLKQVIVTIAEIFWEQTKLKRKRQTATRSQLQPFASQSIDDIISFLNNQTSDNGDDNVCLLIHNIDGPALRDAESQQYLAQVSCCPQVHVVASVDHVNAPLLWDKKMVHTQFKWSWYHVPTFAPYKVEGVFYPLILASGGHAQTMKTALVVLQSLTPNAQSVFRVLAEYQLAHEKEEGMHFSSLYTKCRERFLVSSQVTLNSHLTEFKDHDLVKIRKHSDGQDCLHIPLVSDALEKLLQELT

ORC2

Origin of replication complex subunit 2

363 amino acids

Essential protein (PubMed:15020747). Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity).

Belongs to the ORC2 family.

40.811 kDa

MEDIENIEEDEYGFSRNYFLAKELGGASKRSAHKLSDIHIVDEQELRETASTIEMKHSKEISELMSDYKTMYSKWVFELRCGFGLLMYGFGSKKALVEDFASASLTDYSVVVINGYLPSVNLKQVLLALAELLSELLKCKRKSSGSLSKGQETFPSRSMDDILSFLHGPQSGDKDCFICVVVHNIDGPALRDPESQQTLARLSSCSHIRLVASIDHVNAPLLWDKKMVHKQFNWLWHHVPTFAPYNVEGVFFPLVLAQGSTAQTAKTAAIVLQSLTPNGQNVFKILAEYQLSHPDEDGMPTDDLYSASRERFFVSSQVTLNSHLTEFKDHELVKTKRNSDGQECLNIPLTSDAIRQLLLDLNQ

orc2

ORC1-type DNA replication protein 2

264 amino acids

Involved in regulation of DNA replication.

Belongs to the CDC6/cdc18 family.

29.146 kDa

MTPDSSPSSVDDPLFESGHRIFANKDLLKIGHVPEADRIVGRDEEISKLAKRLNGAVHGYSPENVMIYGKTGTGKSLVSKHVCQRAQNAAQDGVEIGTAYIDCAEDNTETQAISSLAAKLNNESSTGISVPHTGLSTSKYYKLLWKTLDAQFDSVIIILDEIDLMNDDSVLMKLSRAEEAGKIDCSVGVIAISNKIQYVDNVNERVKSSFQHKELFFKPYDANQLREIMFNREDFSSSTTTYSISWPGWTASSCSRARFKAATF