ompL

Porin-like protein L

341 amino acids

Forms pores that allow passive diffusion of small molecules across the outer membrane.

Belongs to the Gram-negative porin family.

36.673 kDa

MNKKLIALAVAAASISSVATAAEVYSDETSSLAVGGRFEARAVLADVNKDENVTNTASSEVSDKSRVRINVAGKTDITEDFYGVGFFEKEFSSADSDNDETRYAYAGVGSQYGQLVYGKADGSLGMLTDFTDIMAYHGNEAGNKLAAADRTDNNLSYVGSFDLNGDNLTVKANYVFGGSDENEGYSAAAMYAMDMGLGFGAGYGEQDGQSSKNGNEDKTGKQAFGAISYTISDFYFSGLYQDSRNTVVNNDLIDESTGYEFAAAYTYGKAVFITTYNFLEDSNASGDASDLRDSIAIDGTYYFNKNFRTYASYKFNLLDANSSTTKAQASDEFVLGARYDF

ompL

Porin OmpL

230 amino acids

Outer membrane channel protein that allows an efficient diffusion of low-molecular-weight solutes such as small sugars and tetraglycine. However, the specific substrate recognized by the OmpL channel is unknown (By similarity).

Belongs to the oligogalacturonate-specific porin KdgM (TC 1.B.35) family. OmpL subfamily.

27.082 kDa

MKNINAIILLSSLTSASVFAGAYVENREAYNLASDQGEVMLRVGYNFDMGAGIMLTNTYTFQREDELKHGYNEIEGWYPLFKPTDKLTIQPGGLINDKSIGSGGAVYLDVNYKFTPWFNLTVRNRFNHNNYSSTDLNGDLDNNDSYEIGNYWNFIITDKFSYTFEPHYFYNINDFNSGNGTKHHWEITNTFRYRINEHWLPYIELRWLDRNVEPYHREQNQIRIGTKYFF

ompL

Porin OmpL

230 amino acids

Outer membrane channel protein that allows an efficient diffusion of low-molecular-weight solutes such as small sugars and tetraglycine. However, the specific substrate recognized by the OmpL channel is unknown.

Belongs to the oligogalacturonate-specific porin KdgM (TC 1.B.35) family. OmpL subfamily.

27.2 kDa

MKKINAIILLSSLTSASVFAGAYVENREAYNLASDQGEVMLRVGYNFDMGAGIMLTNTYNFQREDELKHGYNEIEGWYPLFKPTDKLTIQPGGLINDKSIGSGGAVYLDVNYKFVPWFNLTVRNRYNHNNYSSTDLSGELDNNDTYEIGTYWNFKITDKFSYTFEPHYFMRVNDFNSSNGKDHHWEITNTFRYRINEHWLPYFELRWLDRNVEPYHREQNQIRIGTKYFF

ompL

Porin OmpL

230 amino acids

Outer membrane channel protein that allows an efficient diffusion of low-molecular-weight solutes such as small sugars and tetraglycine. However, the specific substrate recognized by the OmpL channel is unknown (By similarity).

Belongs to the oligogalacturonate-specific porin KdgM (TC 1.B.35) family. OmpL subfamily.

27.119 kDa

MKSLNTLVILTSVISTSVFAGAYVENREAYNLASDQMEFMLRVGYNSDMGAGIMLTNTYTLQRDDELKHGYNEIEGWYPLFKPTDKLTIQPGGLINDKSIGSGGAVYLDVNYKFTPWFNLTVRNRYNHNNYSSTDLNGELDNNDSYEIGNYWNFIITDKFSYTFEPHYFYNINDFNSSNGTKHHWEITNTFRYRINEHWLPYFELRWLDRNVGPYHREQNQIRIGAKYFF

ompL

Porin OmpL

230 amino acids

Outer membrane channel protein that allows an efficient diffusion of low-molecular-weight solutes such as small sugars and tetraglycine. However, the specific substrate recognized by the OmpL channel is unknown (By similarity).

Belongs to the oligogalacturonate-specific porin KdgM (TC 1.B.35) family. OmpL subfamily.

27.135 kDa

MKSLNTLVILTSVISTSVFAGAYVENREAYNLASDQMEFMLRVGYNSDMGAGIMLTNTYTLQRDDELKHGYNEIEGWYPLFKPTDKLTIQPGGLINDKSIGSGGAVYLDINYKFTPWFNLTVRNRYNHNNYSSTDLNGELDNNDSYEIGNYWNFIITDKFSYTFEPHYFYNVNDFNSSNGTKHHWEITNTFRYRINEHWLPYFELRWLDRNVGLYHREQNQIRIGAKYFF

ompL

Porin OmpL

230 amino acids

Outer membrane channel protein that allows an efficient diffusion of low-molecular-weight solutes such as small sugars and tetraglycine. However, the specific substrate recognized by the OmpL channel is unknown (By similarity).

Belongs to the oligogalacturonate-specific porin KdgM (TC 1.B.35) family. OmpL subfamily.

27.105 kDa

MKSLNTLVILTSVISTSVFAGAYVENREAYNLASDQMEFMLRVGYNSDMGAGIMLTNTYTLQRDDELKHGYNEIEGWYPLFKPTDKLTIQPGGLINDKSIGSGGAVYLDVNYKFTPWFNLTVRNRYNHNNYSSTDLNGELDNNDSYEIGNYWNFIITDKFSYTFEPHYFYNVNDFNSSNGTKHHWEITNTFRYRINEHWLPYFELRWLDRNVGPYHREQNQIRIGAKYFF