nuoN2

NADH-quinone oxidoreductase subunit N 2

539 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

57.586 kDa

MNFQIADFTRLIPEFLLLAIAAMVLLGDVLTRWSKGKEALNDRTEEAISMTLMGLGLAFVMVLIQGGFFSWMQFGDWKFYDFSIFQNLRSSGLDGSILGGAFVVDPLTHIGRLVFIGAAFVTVILTSKAKPSNNPAEFYALILFATLGMIFMTAGGELIMIYLGIELTSIPLYVLAGYFRRNPVSTEAGAKYYIFGALSSAILLFGMSLLLGLTLMNGQTMTTTPTSLRSVATAVELAFANPEGPSQGVAILALLFILAGMAYKVAIVPFHAWSPDVYQGAPTSMTAFISTASKTAGFFLLYRVLVTGFGAPSILGTAAIGTSTSFGGWTSLIAILAALTMLVGNLAALPQTNAKRMLAYSSIAQAGFLMLGLVGTQRDSGISLLMYLIAYTVTNLSAFGILALVEDAVGGTDFSNLNGLGRRAPGLALLLTVAILSLAGIPPLSGFFVKFYVFIAAWQEGAKWLVIFAVSNTVISLYYYLRFLKAVYFAPAETDEPIKVGFGPGIVMTAITLLIFGLGIVPTWLYGVLEQATIRIAAQ

nuoN2

NADH-quinone oxidoreductase subunit N 2

532 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

54.775 kDa

MTADLGTTADLSTAPATGGLLAADAPSVVQSIDWLAVAPPTLTALAALAVLVADLFLPAHRKRLLGYAALTALAAALALLIPLRAGDRATFCVTTGTRACSYTADHFTLVIQALVLGGALLTVLLSLDDTRKLPAGEYWFLLLASAAGAALLPASRDLATLVVALEVASLPAFALVGIKRGDRRSSEAALKFFLSSVVATAVMLLGVSFVYATTGTLHLTEIATRLDDVPPVLDTLARTGVALTLVGFAFKTAAAPFHFWVPDTYVGAPLPIAAYLSVVGKAVGFSGLILVTVVAFPSYADVWGPALAVLAALTMTAGNVAALRQNAARARSAVRLLAWSSVAQAGYLLVPIAAAAYSSDDQIGSTVAYALMYAVVNLGAFAVAAVVARTHPGNRLTDYRGLYATRPLAALALGFFLLCLAGLPPGIIGLFAKVTVFSAAVDAGLGWLAVVMAVNVVIALYYYLQWTAILFRAPEGAPETTGTATAPTASAPPRRFRAPTPLTTAIVLTATAGILLSGVPQTVLRFASVSLF

nuoN2

NADH-quinone oxidoreductase subunit N 2

512 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

55.427 kDa

MFQVPSAGEIQELIGALKTGASAFVPEIFLSGLFLLVVTIDLFRIPSKRTIIPAVSVIGLIISGYFVYLQHAIPPDEFFLGMYAVDPFAIFFKYLFIVSGVFAVLISIDSVEVNLPESRSLGEYYSLIVAMVLGMFLMASSTDLLMMFLSLEMVSIISYILVGYLKGQVRSSEAGLKYVIYGSVSSGLMIYGFSIIYGLTGETNIFAINEFLKHNEVDSITLMLGSLLILGGFGYKAGVVPFHFWSPDVYEGAPTPITAYLSVGSKAAGFAMLIRFFRVTIPTGAGSTDLLAFDWVTLLSVVSVVSMVLGNVVALWQSNVKRLLAYSSIAHAGYILLGVIVADDLGTQATLFYLAAYTIMNIGAFFVIILISNEIGSDDVNDYKGLGKKMPLAAASLTIFLVSLTGLPPTVGFIGKLMIFSALLAKGPVFVWLAVIGVLTSVVSLYFYFKIPLNMYLRESEDGSETEFNVGMLSNALVAFLMILTVVFGLYFTPLSVLAEESVKIIGAVVMN

nuoN2

NADH-quinone oxidoreductase subunit N 2

508 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

53.747 kDa

MPGVVSWSQLVNPSYVAILPHLIVTATLLVVIVLDAYFKEKRSLVWVTLGGVVLAMLSIWYTASDPQIQAGIAAGRPPEFWGGMIIADGFTFFMNGVLLGIAALVILLSADYVGKFLRGAHMEFYEIILAVTLGMMFMVSSRDLLTIYIGLELTSISSYVLAGILRKDAKSNEAALKYFLTGATASAVLLFGLSLIYGVTGSTRLPEVAAALAGGSHVVAAAGPALTPLLVAGMAFLMVGFGFKVAAVPVHQWAPDVYEGAPTPVTAFFSAGPKGAAMAAILRVFVGGLGVAPFTDKWALIWALAAAASMTVGNLVALQQTNIKRMMAYSSIAQAGYILVGVAASGLQSVEGISSVLFYVMAYAVTNLGIFAVLTHMDQEGGWVEVDNYAGLAKRNPLYAWALLLFFVSLIGIPPTVGFLGKFFLFRAAAASGYLWLAVLMAVNSVISVGYYYRVVKVMFLDQSDYPALTPSTGISATVLLSLLGVVALTIFANPFVQWTAQSAALLH

nuoN2

NADH-quinone oxidoreductase subunit N 2

506 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

53.565 kDa

MEPRTLDNVASLAYFAPELVLIAAALLLVVWDLASPARLKLAGLVILSLAALACSGGLGAYFLATDAAPRALFHGLLAFDRFSNLFRVIFALVTGAIVLFLVPPRAPGIEPELRRDSGELFTLILVLSLGMNLMAASRHLLLIYLSLELVSVISFVLAGFKINDAKSSEAALKYVIFGGVASGIMLYGMSWIFGITASMRLDECAARIAALTAQQGKVPEVVFVGTAFMLAGFGYKISAAPFHMWTPDVYEGAPTPVTAFLSVGPKAAGFAVLIRFFSDALGAGSAPPGVATPWPVLFGCLAMATMTVGNLSALEQENVKRMLAYSSIAHAGYMLLGFSVFSGAGVAAIAFYIVTYCFMNLGAFMVVMAVAEESGGDETFAAFRGLGRRAPLVAAAMAVFLVSLTGLPPTAGFIGKFYLFSALLAAGGAWSWVIAVVGVLNSVISLFYYARLLRTMYLDRSDRTEPTPVRPLLGGTACALAIPTVLLGVYWGPVYDFVARSVSMLR

nuoN2

NADH-quinone oxidoreductase subunit N 2

498 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

53.069 kDa

MWNDTQMTEIVIPPVDWRVATQLSIIFGWASVLLVIALFVPRSRTRIVGYLAMVGAMVAAAVGIPLWGVNAETFSGMLRLDSYSLTLNWLFLAAAAITMVLSLDYLPRQGIERSEYYVLVLFATGGMMLLAQGADLIILFLGLELLSIVLYVLTGFAYPRNASEEAGMKYLLIGAFAGGFVVFGIALLYGATGSMNLRAIGETLAQQTLTLEERIYLLAGAALVVVGFGYKVAMAPFHMWAPDVYEGAPTPIAGLLSVGSKAAGFAALLRFLVEALAGEWQIWAPVLAVLAIATLAVGNIGALTQRNVKRMLAYSSIGHAGYILFGVIAAGAPGGIAGQRGVEGVLLYLIAYTFTNLGAFGVLIALEHRGEAAWDMSDLAGLWSRRPWLAVAMAVCMLSLAGVPPTGGFWGKFYVFTAAWLSGMGWITVIGVIVAAIAAFYYLRIVAQMFMAEPAREVPLPMDRALRAGLALATLGVLILGFLPTPAIDLVQRVVLGG

nuoN2

NADH-quinone oxidoreductase subunit N 2

494 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

52.203 kDa

MNPVSYSELLRLTLPQIALTVAAFFVLACDGMLLRRSPIAVRARIAMLLSVAGSLVALALLPLTAPVQLLDGMLVLDARTGVVQVVLLLFTLAVTLLSGSVLAQQGREVSAFTTHIGEFFALLLFATVAALFLVSTQNLLLIFLAVEFLSLVLYILTAFNKHSRASAEAALKYFLFGGMSAGFLLFGISLLYGVSGSLDLQQIALAASQPDSLLLVAIVLVILGFGFKIAAAPFHLWAPDAYQGAPSLSAGFIASSSKVASFFVFAQVLFIGVASASGNAAWHLSAPGWMPILAAVAVLSMLLGNLAALAQTSLRRLLAYSAIGHAGYLLLGLIAHTPQSLAALLYYVFTYALAVLGAFGVLAILETNGIDSLSSLAGLSRRSPALSACLLVFLLSLAGIPPLVGFFAKFWLFAAALQAAPAFGLLWLVILAILMSVVALFYYLRVLRQVYVVPMAEDATPLSSPTLARITLLVMAALTLLLGCAPNLLMRWLR

nuoN2

NADH-quinone oxidoreductase subunit N 2

493 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

53.824 kDa

MIDFSLFYNSTDHFSIIPAVMLALFGCAILLFDFLIFPDPRQRKFLLIFVVLAEAFTGFGLFRQQAWLAAQNAPELSGFGGSVTVDGFAIFFNWIFLVAAVVVAIVSYKYLEISGEHHGEYYSLILFAQCGMYFLATGTDLITLFIGLELMALCFYVMVGFLRTERRSNEAALKYLLLGAFSSGFLVYGFSVMYGIAGSTKLSDIAAAIASRPPWDPMVFLALSTTSVGLLFKVSAVPFHMWAPDAYEGAPTTVTAYLSVASKAASIAFLLRIFLGPLASARAVWEPLLAFIAIITLTIGNLAAINQTNIKRLLAYSSISHAGYMLLGLVAGNDTGIKGIAVYVMVYTFMNLGAFLVIIAMRRASIIGEDLDDLAGLVHKSPGYAFLMLIFLLSLAGIPPTAGFLGKYYIFLALIQTGHTGLAIVATLYVAVAIYYYFKIVRSMFIREEMEKTPMLATSFGLRCALALTGIATLAIGIYPEPFLRLAQTSLFR

nuoN2

NADH-quinone oxidoreductase subunit N 2

492 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

53.439 kDa

MSNFQFAIPTIDYIRILPEIVLAVFGIVVMMADALIPQNNSKKPLGYLSLIGVLVSLGAIACQARYPGMYDVNNGTGFWGMVHVDSFSLFFHVLIALITAAVLLVSFEYMDVQRMRSGEYYAIILFSALGMMLMTSATELVLIFIALEISSIGSYVLAAMRRRVAESAESSLKYFLLGSFATAFFLYGVALIFGATGSTNVYTIAAALQNMHPLQPIIYLAVALMFIGLGFKVAAAPFHVWTPDVYEGAPSPIVALMSTGPKAAAFAVLLRVLFAMNAPGWFWIVWVSAALSMTIGNIGALVQSNVKRLLAYSSIAHAGYMLVAFAAAKDAGISAAIFYTATYAAMNVGAFAVVSHFANTGEKYVTLEDYAGLGRRSPLLAAILTVFLLSLIGIPVTGGFFAKFYVFTSALQSHLVWLTIIGVINSAVGAYYYLRIIVYMYMRDEREEVPVARMPFGLALALAMCLMFTIYLGVLPTQFINYALKSAQDLVR

nuoN2

NADH-quinone oxidoreductase subunit N 2

488 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

54.265 kDa

MDLRALIGVIEIPDLKKFLPEFILLLLAFILFTLELFIKGKERRLVLNVVSYVGYFSVLMSLLIPWMYKGDTFYGNFTNDPLAVTVKIFAVLITLAILPFASSYFSAKKSFYGEFYYILAFTLLGVFVLASTYNLIILYVALELVSVGFYILTALLRGSTEAKEGAFKYLILGGLSIALASYGAAFMYIYSGSLDLREILTYQGKDIHYLVLGLVFFLIGLAVKIGAVPFHYWVPDAYQGAPTPVTALMASVGKLAFFIPLVRVMPLVQEKFSLVWTITVGVIAALTMLYGNLVALVQKDVKRLLAYSSIAHSGYIMAGAAVAKVIGMKAVIYFLVAYAVMSAGAFLVLALMEKNPEWQNYMENFYGLRFNAPYIAFAFFVYMVALLGVPPTVGFVGKALVFMALSFDKLWWLAFIMILSAAISTGYYIRLVVVMYMHEREKEIRSAPSHLGEKFSLFALTLASVLLGVLPSLVWFLIKQSAENLFTG

nuoN2

NADH-quinone oxidoreductase subunit N 2

486 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

50.181 kDa

MTAPAFTAKAFAAFAPFTLLGAVTILVMLLIAVRRDHRLVALSTIAGLLLCCIALPLAAPASPVAVTKLFVIDGAALFYAGLVLVSALVVAALSWVYLDRVGEGPREEYYLLLLTATLGAAILPASVHFASFFLGIETLGISLLGLIAYAGPRGSAAEAGTKYLILSGAASAFLLFGMALIYAAFGSMSFARIGALAHQAGPADLYRLAGIALILSGVAFKLSLVPFHMWTPDVYEGAPAPVTAFIAVVSKIAVFAVILRFFALAGAHADASLRAGIAAVAILSMLAGNLLALLQTNVKRLLAYSSIAHLGYLLVAFLAAPALGVDAAAYYLAAYAVTSLGAFGIVALLSAPGAGRDADRIEDYRGLFRTRPFLAASLALMLLSLAGMPPTMGFIAKFYLVVAGVGTALFWPVAALLLGSVIGLYYYLRILVAMALPAPGDEEARHPNAVPPLGNAVIGALLVLLVVLGAYPAPALALIRMTIGHG

nuoN2

NADH-quinone oxidoreductase subunit N 2

479 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

50.622 kDa

MTSFVSFLPELVLLAGALALFVVTLGQNNVRLARILSVATASGVLVAALATVNHSAVLFSGAYRVDAFSQLLKIAIAFGYLCVGILSGQLRDIRGEAKPEYFLFLALSMTGLLALVSSIDVITLIIALELSSFPLYLMVAMRREREGQRVQMESAIKYIMFGIAANGVMFFGFGYLYGLTGSTSLPVILEKLPPLLSSPLAVTGLALTLAGFLYKLAVFPFHFWTPDVYQGSSNETASLIASLPKLGAVAVLVRFVSLAAPGHETLATLLTCLAIASMVYGNLIALVQTDLKRLLGFSGIAHAGYVMVGFVAMDNFGFASALYYIAGYMLMVLACFVVVCQVSRDGANVAITELAGLHKRSPLLAVTLIVGVFALAGVPPFVGFMAKLNLLTSAWQAGHTALVVLTVINSAIAIYYYLQIVRAAFFAESDAQPAPIALTPSMSALCVLLIVAITLLGVAPAFTIDAITNSLATISTVSS

nuoN2

NADH-quinone oxidoreductase subunit N 2

479 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

51.478 kDa

MTAAALLQWALASVPEIIVVTGACVLLIVGELVRKGRDDLLLWASVAIVLLAAVATLMLAGEMRPAYAGMFISDRFAVFFKLVFYLATILTFFLSRKYAEIEGIGRSEYYVLLLFALVGMMIMASAIDLLSIYVGLELMVLCTYVLTGFLRKERRSNEAALKYVILGAVSTAIFLYGVSLIYGLTGTTQLDRMAEAVSGGPLDPALLLAVVFIVAGLVFKIGAVPFHMWVPDVYEGAPTTITAFMSVAPKAAGFAVILRVFLNPLVEASNAWIIVAAIAVATMALGSFVALVQDNFKRLLAYSSIAHAGFAIFGVVAGGQDGIASVMLYLLIYTFMNLGIFGAVIMMRNGDFSGEVIEDYAGFAKFHPGLALLMLLYLFSLAGIPPTAGFFAKFYVLVALVERGFVALAVIAVLLSVVSAYFYIRIVMVIYMREPERAFEPALTPLVSATLAFTAAGTIGIGLFPAWFLRLAQQSAFGG

nuoN2

NADH-quinone oxidoreductase subunit N 2

478 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

52.065 kDa

MNFDIPEFLPALPEIAVLGMGCVLLLAVAYGGGQSGKIAYWITQLTLVIAALLTFYFLDYSSQSVTFNGSYIKDSLSDTLKLFIYIIVFAVFLYSRDYLQARALDKGEFYVLGLFGVLGMMVIASAHHFLTLYLGLELLSLSQYAMVALLRNNRWASEAAMKYFVLGALASGMLLYGMSMIYGATGDLHVAAVAEGIGGSGSSQVLVFGVVFIVVGLAFKFGAVPFHMWLPDVYHGAPTAVTLYIGTAPKIAAFALLMRLLVEALGDVQAHWQDMLIILSVLSMAIGNVVAIAQTNLKRMLAYSTIAHVGFLLLGILTGTGVGYAAAMFYVIVYALMSLGSFGMIIFLSRSNFEADRLEDFKGLNERSPWFAFMMLILMFSLAGVPPTVGFYAKWAVIMAIIDKELLWLAVVAVLFSVIGAFYYLRVIKFMYFDSPTEEISLSKRADFRWCMSANGLAMLGLGIFPGALMGLCVAVLG

nuoN2

NADH-quinone oxidoreductase subunit N 2

472 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

50.331 kDa

MNWMSFAPELITLTSALWFLLLSMTARSDPKREHVAALVLSALGLAACLASVGAEGYCFAGAYKVDLFSQVFKVLLAAGLFLIVTLCGELSDIEERNRREFYVLLFVCTLAMMLLVGANHFLVVFISLELSSYSLYVLVALRRDRGLGLEAGIKYFLVGIFASGVMIFGLALLYGASGIAALDGMARVLPGIIHQPAVVIGLLLTLSGFFFKLAVFPFHFWAPDAYQGAANQVSAYIATASKVAAIGVLVRVIASAGDGGTYLVHVLAVLSVVSMTVGNLAAIAQQDLKRLLAYSTVAHAGYVLIGVLSMNPAGYSAAVFYAFALLVMKFTAFLVLVEVASDGGNLRVEELAGLHRRSPILALALMVSLFSLAGIPPTVGFTGKFLVFVAAMGEGHFTLVLIAMINVVISLYYYLLVIKAAYLLEPRQELPALRVSPPLKLLSGVLVIAMVAAGFFPNQIIRVAESAAKALL

nuoN2

NADH-quinone oxidoreductase subunit N 2

467 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

49.518 kDa

MSIFSLLPELWLLGLVCALFVASISDKKQSVASWLPMAAGLGVLAALFALGERGEFLYAAYKLDGLSQFFKLLIAFGFAVVTGIAAGNKEGKDLTPDYFMLLALSAWGLMLLASCVELITLYLALELSSYSLYALIPLRGQDRRAAEAGIKYILFGAAVTALALFGLSYIIAAKHTTYLSGLAATSWSFADAPMAVIGLTLFLAGFFYKLALFPFHFWCPDVYQGAKNETAAYVATIPKLGAVVVLVRLAAFVAPHLEVTTILAILGAVSMTAGNLAALVQRDLKRLLGFSSVAHAGYVMLGLAAGSAAGMSAAAFYSLAYILMNLAAFYVVCAIAKNDENPSLDDLDGLYKRAPALAMILAVAAFSLVGLPPTAGFAGKLFLLSAAWDQGYHWLVIVAVLNTAISIYYYLSMVRHAYTGESDAPAIVWPRGYLIFGGALAVLVLLLGILPAPLYDLAAQAAGQLHP

nuoN2

NADH-quinone oxidoreductase subunit N 2

464 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

51.316 kDa

MKALYPDIITTVGIIFLIILELFLPSFDLIGFLGFLISFISGVLAIKYSLAGYRFNEWLLDINAFSLLLKGVMYILTSFVIFSSVSFFKSKKTFVENVYTFLLISLGLSIMVSSKNLAVILAGLELASISMYISVGMLRDDYISKEASFKYLVLGSMTTAFFGIGSAFYIGATSHLDIISVSVNHNTAFALASLFLFVAFALKVSAAPFHFWTPDAYEGAPTSNTAFISTVPKIGFYAVLFLLASYIFPVTNNFSYIVGIVGVISMFWGNLVAYAQNSAKRMLAYSSIGHAGYFLIGFSRYNPLSVSSTIFYVIVYAFATAGAFLVLSILEKNQSWTHDMSNYRALYKRSPFLATALALFLFALIGIPPFATFVGKLGIFLGLVNSNAWFFAILFVIGSIIAAGYYLKLIVYMFFKEPATKDNMSLSLNLFDTIGISAFLIIVFFFGIFPNILFDIILKDMFHG

nuoN2

NADH-quinone oxidoreductase subunit N 2

452 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

50.786 kDa

MIQYKVLIPEISLLILAIISFFYGFISRNYRTTYILSFLSILTAIILSVFNFGQKEFTSELIKIDLYRQTLRILVLFIGVFIIGLSYSDLKLKSSKSVEYVFLLLLSLFGMNLMIVANDLLILYLALETFSLSLYILAGFYRKESLSIEAGMKYFILGTLSSIILLGSIVFFYAQTGSTSYETFKLLKTENLNILLGVVFLISAFAFKLSLAPFHAWAPDVYQGAPTAVTAFLSTAPKVAVFGALINIFLSINLKLNIQDLIVIISALSMLVGNVLALRQNNLKRMLAYSSIAHAGYMFMAFLLPEKELLISLIPYLIVYVFMNLSAFAFIMNIKNGESIQNYLGVGRKNPLLSFCIIVIMFSLTGVPPTAGFIVKFNLFKNLLSYGYGSLVFFALLMSIFSAFYYLRPVFYLYKDSLVIDIYNHPLNNSMALSGALLLIFLGLFPNLLLIF