nuoK2

NADH-quinone oxidoreductase subunit K 2

148 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

15.42 kDa

MHLAYPAVLAALLFCVGLYGVLARRNAILVLMSVELMLNAVNLNLVAFDVWLRDTLHSGQALTLFTIAIAAAEIGIGLAIVLAVYRNRGTSAIDRLRDTAETDAAETLPDDAGTGPSGTDAAPNGDTTTATGRPGDNAGKNKKAEATR

nuoK2

NADH-quinone oxidoreductase subunit K 2

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

13.479 kDa

MHLAYPAVLSALLFSTGLYGVLARRNAILVLMSVELMLNAVNLNLVAFDVWLSKTARDTLHSGQALTLFTIAIAAAEIGIGLAIVLAVYRNRGTSDIDKLRDTAEGPEPDGPGTDGSAPTAAEKAEATA

nuoK2

NADH-quinone oxidoreductase subunit K 2

114 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

12.164 kDa

MIVPFGHVLLLAGALFGLGVFCAVARRNLIMIVLGVEIMLNAASIAFIGAAARWQSMEGQAFVLFILAVAATEVSIGLAIIVYAFRRTGSFDPAAYNLMKAGDAMQSFERRGPQ

nuoK2

NADH-quinone oxidoreductase subunit K 2

107 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.7 kDa

MELPIYYPLGLGALLFGLGLWGALTQKNAVRILMFIEIMLNGVNLNLITFSRYYWQTSPEMAARAPILTLFVMTVAAAEASVGLAIILAMVRNRGVVEVDKATLLKG

nuoK2

NADH-quinone oxidoreductase subunit K 2

103 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.466 kDa

MSSTIPLAWYLMLSAFLFICGVIGFMIKRNIITIFMCIELMLNAVNLTFVAYATELRSLSGHIFVFFVMVVAAAESAVGLGIIIAVFRSRETLNVDRVNLLKL

nuoK2

NADH-quinone oxidoreductase subunit K 2

102 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

10.905 kDa

MKTIPLEAFLTVSMILFGLGLIGIIARRNLVTVLMSLELALNAVNIALVGADHYLGLAEGQIFALFIIALAATEAAVGLGIIIAIFRLKKVESTDEIRELRG

nuoK2

NADH-quinone oxidoreductase subunit K 2

102 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.255 kDa

MIVPLLHILILAGILFVLGLVCTMVWRMNIIMMLIGIEIMLNAAMLAFVGAANRWGTADGQVFSLMIMAMTSAEVSLALALVVYLHRWRKTVNADDFNSMKG

nuoK2

NADH-quinone oxidoreductase subunit K 2

102 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.189 kDa

MIVPFEHVLILAGLLFALGLVCVLVWRMNLIMLLIGIEVMLNAAMLAFVGGAARWGMADGQVFSLIIMALTSAEVSLALAMVVYLHRRKKTVDADEFRELQG

nuoK2

NADH-quinone oxidoreductase subunit K 2

102 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

10.374 kDa

MTGSDLIGIMILAAGLFAVGVFGVLARRGMLFQLVALEVALSGPALGFIAAGAYHADPEGQGMFILVLTLAAAEVAVGLALFLRLRRLTGTDDSDAISGLKG

nuoK2

NADH-quinone oxidoreductase subunit K 2

102 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.083 kDa

MHPITPVHYLALSAALLLIGTVGVLTRRNIVIILMSIELILNAVNINLIAFSHALQNINGQIFAIFVITDAVAEAAVGLGILIALFRNKETVQADEIDLLKW

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.061 kDa

MLAIENYLILSAILFSIGTIGVLTRRNAIVIFMCIEMMLNAVNLTFIAFSRHLGNIDGQVFVFFVMTVAAAEAAVGLALMIAFFKNRESIDVEDVNLMKL

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.068 kDa

MVSLHSYLILSAILFSIGTIGVLIRRNAIVIFMCVEMMLNSVNLTFIALSKHLGNVDGQIFVFFVMTVAAAEAAVGLALMIAFYKNRESIDVEDIKLMRL

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.027 kDa

MLAIENYLILSAILFAIGTIGVLTRRNAIVIFMCIELMLNAVNLTFIAFSRHLGNIDGQVFVFFVMTVAAAEAAVGLALMIAFFKNRESIDVEDVNLMKL

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.131 kDa

MLALNNYLILSAILFSIGTIGVLVRRNAIVIFMCVEMMLNAVNLTFIAFSKYLGNIDGQIFVFFVMTVAAAEAAVGLALMIAFYKNRESIDVEDVNLMKW

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.004 kDa

MVPLWWFIVLGVVLFVIGAAGVLLRRNILVVLMSLELLLNSVNINFIAFGHYYDDFRGQIFAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTMLKG

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

11.038 kDa

MVPLWWYIVLGVVLFVIGAAGVLIRRNILVVLMSLELLLNSVNINFIAFGHYYDDFRGQIFAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTMMKG

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

10.921 kDa

MVPLWWSILLGVALFVIGAGGVLLRRNILIVLMSLELLLNSVNINFIAFGQYYDDFRGQIFAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTIMKG

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

10.915 kDa

MVPLWWHISLGVALFVIGAAGVLLRRNILVVLMSLELLLNSVNINFIAFGRYYADFRGQIFAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTVMKG

nuoK2

NADH-quinone oxidoreductase subunit K 2

100 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

10.822 kDa

MVPLSWSILLGVALFVIGAGGVLLRRNILIVLMSLELLLNSVNINFIAFGQYYDDFRGQIFAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTIMKG

nuoK2

NADH-quinone oxidoreductase subunit K 2

99 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 4L family.

10.737 kDa

MNPVNYLYLAALLFTIGATGVLIRRNAIVVFMCIELMLNACNLAFVAFSRMHGNLDGQIIAFFTMVVAAAEVVVGLAIIVSLFRSRHSASVDDASLMKL