nuoJ

NADH-quinone oxidoreductase subunit J

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

23.142 kDa

MPIFFYLFTTLIIISSLCVVLSKNSVYSVLWLIFTFINGSGLMILLGAEFLAMLLIVIYVGAVAVLFLFVIMMLDINFNQAITKLRENLSLSIFITLIMFADLVITIILSTKNINYSSNISFAIANNISNTKAIGNVLYTEFMLPFQIAGLILFVAMISCITLTLKKRDRIKHQDIRKQLSHNKSNVILMTKPILNKGVENIKYE

nuoJ

NADH-quinone oxidoreductase subunit J

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

23.101 kDa

MPIFFYLFTTLIIISSLCVVLSKNSVYSVLWLIFTFINAAGLMILLGAEFLAMLLIVIYVGAVAVLFLFVIMMLDINFNQAITKLRENLSLSIFITLIMFVDLVITVILSTKNINHSSNISFAIANNISNTKAIGSVLYTDFMLPFQMAGLILFVAMISCITLTLKKRERVKYQDIRKQLSHNKGNVILMTKPILNKGVENIKYE

nuoJ

NADH-quinone oxidoreductase subunit J

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

22.951 kDa

MPIFFYLFTTLIIISSLCVVLSKNSVYSVLWLIFAFINGSGLMILLGAEFLAMMLIVIYVGAVAVLFLFVIMMLDMHFNKAIMQLKEKPILSIFVSLIMFADLVVIILLGTKNIHFSSDLSFAIASDVSNTKAIGKILYTDFMIPFQIAGLILFVAMIGCITLTLRKRDGVKRQNIAKQLSHNKENAVLMTKPLINKGIENIKYE

nuoJ

NADH-quinone oxidoreductase subunit J

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

22.917 kDa

MPIFFYLFATLITISSVCVVLSKNSVYSVLWLIFAFINGAGLMILLGAEFLAMMLIVIYVGAVAVLFLFVIMMLDMHFNKTITQLKANLALSIFIALIMFADLVIIILLGTKNINFNSNVSFTITNNISNTKAIGGVLYTDFMLPFQMAGLILFVAMIACITLTLKKREGVKRQDISKQLRHNKENTVLMTKPILNKGVENIKYE

nuoJ

NADH-quinone oxidoreductase subunit J

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

22.943 kDa

MFIFFYLFATLITISSLCVVLSKNSVYSVLWLIFAFINGAGLMILLGAEFLAMMLIVIYVGAVAVLFLFVIMMLDMHFNKTITQLKENLALSSFIALIMFADLVTIILLGTKNINFISDVSFTITNDISNTKAIGKVLYTDFMLPFQMAGLILFVAMIACITLTLKKREGVKHQDITKQLSHNKSNVVLMTKPTLNKGVENIKYE

nuoJ

NADH-quinone oxidoreductase subunit J

202 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 6 family.

21.733 kDa

MTVFVFAFYLFAVVAVVAGLMVVLSKNPVHAVLWLILTFLSAAGLFVLMGAEFVAMLLIIVYVGAVAVLFLFVVMMLDIDFAALRGQLVRYAPVGGLIALVMLAQLATGLMVWNTADAANGLRAAPAPEGVENTAALGMILYDRYLYLFQGAGLVLLVAMIGAILLTLRHRTDIKRQNVLAQMHRDPAKALEMVDVKPGQGL

nuoJ

NADH-quinone oxidoreductase subunit J

184 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.875 kDa

MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRKDDSAKRKTEEHA

nuoJ

NADH-quinone oxidoreductase subunit J

184 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.875 kDa

MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRKDDSAKRKTEEHA

nuoJ

NADH-quinone oxidoreductase subunit J

184 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.875 kDa

MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRKDDSAKRKTEEHA

nuoJ

NADH-quinone oxidoreductase subunit J

184 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 6 family.

19.875 kDa

MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRKDDSAKRKTEEHA

nuoJ

NADH-quinone oxidoreductase subunit J

170 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.088 kDa

MEFVFYVCSFAAVVSTFFVIIQKNAVYSLVYLIISLLSIAGVFFSLGAFFAGSLEVIIYAGAIIVLFVFVIMMLNISDKYNLEEAHYLKPRFWIGPSILSLILLLSMTYAIFFLRDKKIDGFLIDSKIVGINLFGPYVFLVELSSILLLSALVVIFHIGTEKNVDKNKVL

nuoJ

NADH-quinone oxidoreductase subunit J

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

17.584 kDa

MEFAFYFAAGVAVLATLRVITNSNPVHALLYLIISLLAISMTFFSLGAPFAGALEIIVYAGAIMVLFVFVVMMLNLGPAVVEQERKWLTPGIWVGPSALALVLLVELLVVLARTPSGAGIGHTTVDAKAVGISLYGPYLLVVELASMLLLAALVAAYHLGRQDAKQ

nuoJ

NADH-quinone oxidoreductase subunit J

164 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.144 kDa

MEFFFYSSSLATIVFTVCSIFSRNLMYSLLYLILSFVFTSCVFFSLGATFAAALEVIIYAGAIMVLFVFFIMMFNFKKSTLYAEKIFDKNNYYYINFLFLLCILIFPFFFILSYLYKEKIFYMVVSTKLVAIKLFSDYILVIELSSIVLLSALIIVSHIGKIRR

nuoJ

NADH-quinone oxidoreductase subunit J

163 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

18.381 kDa

MEFVFYACSLIAVISTLLVIIQKNAVYSLLYLIISLLSISGIFFIFGAFFAGALEVVIYAGAIIVLFVFVIMMLNLGKKNDLQEKKYLNPIFWIGPSFLSLILFLLMTYAIFFVKDKQIYFSLIDVKEVGINLFGPYLLLVELSSLLLLSALVVVFHIGKEKK