nuoH

NADH-quinone oxidoreductase subunit H

467 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

51.16 kDa

MSPYLAAEDLSMFGTDPWWLVVIKAVFCFAFLMVTVLFSIVWERKVVAWMQLRIGPNRHGPWGMLQSLADGIKLMLKEDVIVKRADKAVYVLAPIVAAIPAFMAIAVIPFGPAGNEVSIFGHRTAMQLTDLPIAMLFILAVASVGIYGIVLAGWSSGSTYPLLGGLRSCAQMISYEIAMGAAFASVFLYSGSMSTSEIVAQQDDRWYIVLLPVSFILYIVTMVGETNRAPFDMPESEGDLVGGFNTEYSSIKFAMFMLAEYVNMVTVSAVATTLFLGGWRAPWPISTFWEGANHGWWPLLWFVVKVQLLLFFFIWLRGTLPRVRYDQLMKLGWKVLIPVSLVWLMLVATVRALRNENYGFSDIALYIGGGVLVLLLLSFLVDMYRDKGGKAADQPAETGTGTGTGTETAFDPMAGGFPVPPMPGQQVPPVPRRRPRRERELIVSGGPDTHSDGPAGGPTDGKEASDG

nuoH

NADH-quinone oxidoreductase subunit H

454 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

50.27 kDa

MTPYLAAEDLSMFGRDPWWLVVVKAVFCFAFLMITVLFSIVWERKVVAWMQLRIGPNRHGPWGMLQSLADGIKLMLKEDLIVKRADKVVYVLAPIVAAIPAFMAIAVIPFGPADNEISIFGHRTAMQLTDLPIAMLYILAVASVGIYGIVLAGWSSGSTYPLLGGLRSCAQMISYEIAMGAAFASVFLYSGSMSTSTIVEQQHDRWYIVLLPVSFVIYIVTMVGETNRAPFDMPESEGDLVGGFNTEYSSIKFAMFMLAEYVNMVTVSAVSTTLFLGGWRAPWPISTFWEGANHGWWPMLWFVVKVQLLLFFFIWLRGTLPRVRYDQLMKLGWKVLIPVSVVWLMLVATVRTLRNENYDFADIALYVGGGVLVLLLLSFVADMFREKSKEAAAPAEEPAAFDPMAGGFPVPPLPGQTLPPVPRRRPRRDRELIVSGGPDTASDGPANGKEASDG

nuoH

NADH-quinone oxidoreductase subunit H

452 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

49.786 kDa

MTPTTVVSAAALDAEPGLDAFGNDPWWIILIKALAVFVFLMLCVLMMIMADRKVMGRMQQRHGPNRFGPWGLLQSLADGVKLSLKEDLIPRTVDKVIYIAAPMIAAIPAFFAFSVIPVGPEVTMFGVETRLQLTDLPVAVLLVLATASLGVYGIVLAGWASRSPYPLLGGLRASAQVISYEIAMGLSFIAVFIYAGTLSTSGIVEAQQNIWFAVILFPSFVIYLITMIGETNRLPFDLPEGEGELVGGFMTEYSSMKFTMFFLAEYVNMVTVSAMSVTLFLGGYLAPPPITTFWPGANEGWWPALWWLIKFVCVMFLFVWVRGSLPRVRYDQLMKLGWKILIPIQLVWITAVAVIRVLNNQEYPGYVTAIVVGVFGLLVFLGLWAWSRAAAKAKAQEAAEHEAELRARRENPMYGGFPVPPMIAPHYGTSVLAEEPRYQPASAPKREEVSGA

nuoH

NADH-quinone oxidoreductase subunit H

451 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

48.976 kDa

MTVTTLGHPLAPVFAAAPLSPPTHRDIWWLIIVKTLGVFAFLVLATLFMIWAERRVVARMQQRIGPNRVGPFGLLQSLADGLKLALKEDIVPTLADKAVFILAPVISATPAFLAFAVIPFGPTVSIAGHHTNLQLTDLPVAVLFVLAMSSLGVYGIVLAGWSSGSPYPLLGGVRSAAQVVSYEIAMGLSFVGVFLYSGSLSTSDIVAAQAHRWGILWAGVSFAVYAIAMVGETNRAPFDLPEGETEIVGGFHTEYTSLKFALFYLAEYINMVTVSALMTTLFLGGWRAPWPLSLWSQANVGWWPVLWFLIKLGIVLFVFIWLRGTLPRFRYDQFMQFGWKVLIPVNLTWILVEAAIRVVNVSNWRVWVIPFAIFLALVAVGTYVADLVRQRSEVGDGGPILGPALVPNPDSPYPIPPLPGQRPLVGVLEARTDDFPVGSAAEPRNGGDGDA

nuoH

NADH-quinone oxidoreductase subunit H

450 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

49.022 kDa

MTIEGVYPDPALFGHDPWWLVLGKALAIFVFLVLTPLLTILAERKVMAWMQMRVGPNRVGPRGMLQSLADGIKLALKEGIVPKGVDKPIYILAPVIAAVPAFMAFAVIPFGPAVSIFGHYTPLQLTDLPVAVLYVLAATSIGVYGIVLAGWASGSTYPLLGGLRSTAQVISYEIAMALSFAAVFLDAGTMSTSGIVAAQEHTWYVFLLLPSFLIYVTSMVGETNRAPFDLPEAEGELVGGFHTEYSSLSFAMFMLAEYVNMVTVSALATTLFLGGWHAPFPLSLWDGANSGWWPVLWFTLKVWGFLFVFVWLRATLPRLRYDQFMGLGWKILIPISLVWVMIVATVRAFRNEGYDARSIALVVAGLVVALVVVVLLWKRLRPGRVPAPEKPVEPRGRAELSPETLEPFDPMAGGYPVPPMPGQTLPAFRRTPVSVTGAHSTGPTQENSDD

nuoH

NADH-quinone oxidoreductase subunit H

449 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

48.538 kDa

MNTLTAPLPMATDALSQFGHDAWWVIGLKAVLILVVLLLLTLFNIWFERRVVGRMQHRPGPNVNGPFGLLQSLADALKLIFKEGIIPKAADKAVYLIAPVIAVIPSFITFSVIPFGPEVTIPFTDTRTPLQLTDMPVAVLFVMAIASIGIYGIVLGGWSSGSTYSLLGGLRSSAQMISYEVAMGLALVAVFLYAGSMSTSEIVAAQDNLWYGLILVPSFVIYLIAMVGETNRAPFDLPEAEGELVGGFHTEYSSMTFALFFLAEYINMATVSAVATTLFLGGWHAPFWLDHAWAGANEGYWPLLWFLGKVLFFVFIFIWLRGTLPRLRYDQFMAFGWKRLIPVALVWIVAVATIRSISLDGGVDRRYLLIGIGALAVVFLVLFFIGGAAEEQPTTVPEAAPAGGYPVPPMPAGGPVRGAAVPLTFDRSSPIASSMPQPSAATRSAGEEI

nuoH

NADH-quinone oxidoreductase subunit H

449 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

48.753 kDa

MSVTASTLVLAAPVDPDLSGFGDDPFWLILLKGVAVFAFLLLMTLFSIVFERKVVAKMQQRVGPNRHGPKGWLQSLADGAKLMLKEDLIPALADKPIFILAPILSAVPAFLAFAVIPFGPEVSIFGERTTLQLADLPVSVLYMLAAASLGVYGLILSGWSSGSTYPLLGSLRSAAQIISYEVAMGLSFVAVFIYAGTLSTSGIVESQSGRWYIALVPSFVLYCISMVGETNRTPFDLPEAEGELVGGFHTEYSSIKFAFFFLAEYINMVTVSAIATTLFLGGWQPPPIPGLSGLDHGWVPLIWFVLKLLLFLFFFIWLRGTLPRLRYDQFMAFGWKVLIPVGLLWVLVIATFRVYQKDVDDRTPWLIGAGVVIGIMLIVALLDPGGAKHQRELEEAERRKLAEAPSLESIPWPPPPPGGAHHRPAVPAGTSANGSSTVIPADPPPRQES

nuoH

NADH-quinone oxidoreductase subunit H

449 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

48.741 kDa

MSATPSTLVWAAAADPDLHAFADDPFWLILLKAVAVFAFLLLMTLFAIVFERKVVAKMQQRVGPNRHGPRGWLQSLADGAKLMLKEDLIPVLADKPIFILAPIVSAVPAFLAFAVIPFGPEVSIFGERTTLQLADLPVSVLYLLAAASLGVYGLILSGWSSGSTYPLLGSLRSAAQIISYEVAMGLAFVAVFIYAGTLSTSGIVAGQSGRWYIVLVPSFVLYCISMVGETNRTPFDLPEAEGELVGGFHTEYSSIKFAFFFLAEYINMVTVSAIATTLFLGGWQPPPIPGLSGLNSGWVPLIWFVLKLLAFLFFFIWLRGTLPRLRYDQFMSFGWKVLIPVGLVWVLAVATFRVYQKHVDDRTPWLVGFGVVVGILLIVALIDPGGARHQRELEEAEQRKLAEAPSLDRIPWPPPPQAAGRGRPAVSAGASANGSSTVIPADPGPRQER

nuoH

NADH-quinone oxidoreductase subunit H

441 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

47.392 kDa

MTNTAELLADDPIWLVLIKVVAIFAFLVVMTLFSIWAERRVIGRMQHRPGPNRAGPFGLLQSLADGLKLAFKEDIRPVLADKWVYFLAPVISATPALVAFSVIPIGGEVSVFGQQTALQLVELPVGLLVVLACASIGVYGIVLAGWSSGSPYPLLGSLRSAAQVISYEIAMGLSFVAVIMYAGTLSTSGIVEAQKDGWFALLLPFSFLVYVVSMVGETNRAPFDLPEAESELVGGFHTEYSSLKFALFFLAEYINMVTVSALATTLFLGGWHAPWPLSAIGGGVLNTGWWPVLWFLGKTLAFLFVFVWLRGTLPRLRYDQFMNLGWKFLVPLSLLWIIAVTVIRALRNNDAVTSQQFLIAGGVVIAVLLVATFLIPDRKVPESDGEVPLAGSGYPIPPLDLEVPKAPPRRSAVHAGAQAAPAGQLPGEGAGSTKEEPNGSV

nuoH

NADH-quinone oxidoreductase subunit H

440 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

48.287 kDa

MSPLEATIDPVWLIIVKVVILFVILLAWTIFNVWFERRVLAKMQNRIGPIMNSAWAGGVFQAVGDGLKLIFKEMLTPKGADKIVFNLAPVIAGIACFASWSVIPLGGQVSMFGHTTRLQITDVPVAVLFILAVASIGIYGVVLAGWSSAGTYSLLGSLRSSAQMISYEVAMGLSLVTVFIFSGSMSTSQIVESQANHLVVGGFDTHIAGHYWLLLIPSFVIYVITMFGESNRLPFDLPECESELVSGYITEYSGFPYGMYFLAEYINMATLSAVCTTLFLGGYRAPWPLNYFGVIDSGWWGLLWFFLKTQLVIFFFVWVRAAIPRFRYDHFMDLGWKVLIPVSLGWVLLVAAWRTVINQGWGRNPVFLVVVGVILVALIVWAFMGGKTDSTADEAPDEPFDAFAGGYPVPPLPHQVQAPLAGAATATTVARRDHDENGGL

nuoH

NADH-quinone oxidoreductase subunit H

424 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

46.478 kDa

MTDFGHDVWWLVVAKAIAIFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGSLQSLADGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPVVSVFGHRTPLQLTDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFAAVFLYAGSMSTSQIIAAQDRVWYIFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMTTVSALAATLFLGGWHAPWPLNLWHGANAGWWPVLWFTAKVWGFLFMYFWLRATLPRLRYDQFMALGWKLLIPVSLVWVLIAAVIRTLRNQGYQYWTPALVVSSIVVAAILVMSLRKPFSTPNAVTKARRRGKQPAAGPDEQGALEPLFPTPPLPMKPLAQPVGASKENARG

nuoH

NADH-quinone oxidoreductase subunit H

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

45.652 kDa

MTTPLTAFGHDPWWLVLGKALAIFVFLMLNVLVAILLERKILGWMQLRPGPNRVGPWGVLQSLADGIKLALKETITPGGVDKFVYFAAPVISTIPAFTAFAFIPFGPVVSVFGHRTPLQLTDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFAAVFLYAGSMSTSQIVAAQDRVWFVFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMMTVSSLATALFFGGWHAPWPLNMWAGANTGWWPVLWFTAKMWTFLFIYFWLRASLPRLRYDQFMGLGWKLLIPASLVWVLIAAVIRTLQNQGYAHWTPILVISSIVFAAALVLSLRKPFTTPHIRALRRAAAPPGQAAAHRAGFHPGIPDTAAAGESAGGRE

nuoH

NADH-quinone oxidoreductase subunit H

416 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

45.259 kDa

MIHPDPTLFGHDPWWLILAKAVGVFVFLVLTVLAAILIERKVLGRMQMRFGPNRVGPKGLLQSLADGIKLALKEGITPAGVDKPVYLLAPVISVIPAFLAFAVIPMGGEVSVFGHRTALQLTDLAVAVLYILAVTSVGVYGIVLAGWASGSTYPLLGGLRSSAQVVSYEIAMALSFATVFLYAGTMSTSGIVAAQTSTWYVFLLLPSFLVYVTSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMTTVSALATTMFLGGWHAPWPISLWEGANSGWWPLLWFTAKVWVFLFVYIWLRGTLPRLRYDQFMAIGWKMLIPVSLAWIMIVATAHSLRTTGHGGWASGLLIAGTVLTFGLAVILWRTMRFRADRTVPARTAADVFPIPPIPGRAGTARTPESRETTDA

nuoH

NADH-quinone oxidoreductase subunit H

416 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

45.215 kDa

MIHPDPTLFGHDPWWLILAKAVGVFVFLVLTVLAAILIERKVLGRMQMRFGPNRVGPKGLLQSLADGIKLALKEGITPAGVDKPVYLLAPVISVIPAFLAFAVIPMGGEVSVFGHRTALQLTDLAVAVLYILAVTSVGVYGIVLAGWASGSTYPLLGGLRSSAQVVSYEIAMALSFATVFLYAGTMSTSGIVAAQTSTWYVFLLLPSFLVYVTSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMTTVSALATTMFLGGWHAPWPISLWEGANSGWWPLLWFTAKVWVFLFVYIWLRGTLPRLRYDQFMAIGWKMLIPVSLAWIMIVATAHSLRTTGHGGWASGLLIAGTVLTFGLAVVLWRTMRFRADRTVPARTAADVFPIPPIPGRAGAARTPESRETTDA

nuoH

NADH-quinone oxidoreductase subunit H

416 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

45.259 kDa

MIHPDPTLFGHDPWWLILAKAVGVFVFLVLTVLAAILIERKVLGRMQMRFGPNRVGPKGLLQSLADGIKLALKEGITPAGVDKPVYLLAPVISVIPAFLAFAVIPMGGEVSVFGHRTALQLTDLAVAVLYILAVTSVGVYGIVLAGWASGSTYPLLGGLRSSAQVVSYEIAMALSFATVFLYAGTMSTSGIVAAQTSTWYVFLLLPSFLVYVTSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMTTVSALATTMFLGGWHAPWPISLWEGANSGWWPLLWFTAKVWVFLFVYIWLRGTLPRLRYDQFMAIGWKMLIPVSLAWIMIVATAHSLRTTGHGGWASGLLIAGTVLTFGLAVILWRTMRFRADRTVPARTAADVFPIPPIPGRAGTARTPESRETTDA

nuoH

NADH-quinone oxidoreductase subunit H

413 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

45.063 kDa

MLAAALRAAGVDVSGWSQTGQYALWLVAMAVLALILVSFGAVISGMTVWWEMRVSARMQSRIGYNRVGAAGFFQWIADAVKLLLKEDLIPADADRLLFRAAPYFVLVGFALVFVALPFGESLIAADLNVGIFYITAVTALVVVGILVAGWSSNSKWALFGGMRSAAQVISYEIPAGLAVMVPVLMSGTLSMQGIIRSQGAWPWEWHALTNPFAMVAFAIFFVAQLAEGNRTPFDLPEAESELVAGYLSEYSAFRFALFFLVEFGNLWVMSAISVTLFFGGWQVPFAGPEVFAAARGAGDLPGLAWWGLQLASMLVFVAKTLVLLNVVVWVRWTLPRIRVDQMMSLCWKYLVPFAFVCFVATLLWQILVARVPATAPVVGGLMLVAAIVAGFSFLRLTRRNISAVGDRVDFTNW

nuoH

NADH-quinone oxidoreductase subunit H

411 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

44.735 kDa

MTYPDPTLFGHDPWWLVLAKSLGIFAFLLLTVLAAILIERKVLGRMQLRFGPNRVGPHGLLQSLADGVKLALKEGLVPAGVDKWIYLAAPIISVIPAFMAFAVIPMGGEVSVFGHRTALQLTDLPVAVLYILAVTSIGVYGIVLAGWASGSVYPLLGGLRSSAQVISYEIAMALSFAAVFIYAGTMSTSGIVAAQNDTWYIVLLLPSFLVYVTAMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMTTVSALATTLFLGGWHAPWPISIADGANSGWWPLLWFTVKVWLFLFFFMWLRATLPRMRYDQFMALGWKILIPVSLGWIMIVAITHSLRDQGYQAPATAAIGLAVAAVILLALLGRSRLRARRIRPEPIRPAGDGAFPVPPLPVKTRALEDADA

nuoH

NADH-quinone oxidoreductase subunit H

410 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

44.658 kDa

MTTFGHDTWWLVAAKAIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGALQSLADGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPEVSVFGHRTPLQITDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFATVFLMAGTMSTSQIVAAQDGVWYAFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMTTVSALAATLFFGGWHAPWPLNMWASANTGWWPLIWFTAKVWGFLFIYFWLRATLPRLRYDQFMALGWKLLIPVSLVWVMVAAIIRSLRNQGYQYWTPTLVFSSIVVAAAMVLLLRKPLSAPGARASARQRGDEGTSPEPAFPTPPLLAGATKENAGG

nuoH

NADH-quinone oxidoreductase subunit H

410 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 1 family.

44.658 kDa

MTTFGHDTWWLVAAKAIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGALQSLADGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPEVSVFGHRTPLQITDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFATVFLMAGTMSTSQIVAAQDGVWYAFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMTTVSALAATLFFGGWHAPWPLNMWASANTGWWPLIWFTAKVWGFLFIYFWLRATLPRLRYDQFMALGWKLLIPVSLVWVMVAAIIRSLRNQGYQYWTPTLVFSSIVVAAAMVLLLRKPLSAPGARASARQRGDEGTSPEPAFPTPPLLAGATKENAGG

nuoH

NADH-quinone oxidoreductase subunit H

410 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 1 family.

44.658 kDa

MTTFGHDTWWLVAAKAIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGALQSLADGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPEVSVFGHRTPLQITDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFATVFLMAGTMSTSQIVAAQDGVWYAFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMTTVSALAATLFFGGWHAPWPLNMWASANTGWWPLIWFTAKVWGFLFIYFWLRATLPRLRYDQFMALGWKLLIPVSLVWVMVAAIIRSLRNQGYQYWTPTLVFSSIVVAAAMVLLLRKPLSAPGARASARQRGDEGTSPEPAFPTPPLLAGATKENAGG

nuoH

NADH-quinone oxidoreductase subunit H

410 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 1 family.

44.658 kDa

MTTFGHDTWWLVAAKAIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGALQSLADGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPEVSVFGHRTPLQITDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFATVFLMAGTMSTSQIVAAQDGVWYAFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMTTVSALAATLFFGGWHAPWPLNMWASANTGWWPLIWFTAKVWGFLFIYFWLRATLPRLRYDQFMALGWKLLIPVSLVWVMVAAIIRSLRNQGYQYWTPTLVFSSIVVAAAMVLLLRKPLSAPGARASARQRGDEGTSPEPAFPTPPLLAGATKENAGG

nuoH

NADH-quinone oxidoreductase subunit H

410 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

44.658 kDa

MTTFGHDTWWLVAAKAIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGALQSLADGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPEVSVFGHRTPLQITDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFATVFLMAGTMSTSQIVAAQDGVWYAFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMTTVSALAATLFFGGWHAPWPLNMWASANTGWWPLIWFTAKVWGFLFIYFWLRATLPRLRYDQFMALGWKLLIPVSLVWVMVAAIIRSLRNQGYQYWTPTLVFSSIVVAAAMVLLLRKPLSAPGARASARQRGDEGTSPEPAFPTPPLLAGATKENAGG

nuoH

NADH-quinone oxidoreductase subunit H

410 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 1 family.

44.658 kDa

MTTFGHDTWWLVAAKAIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGALQSLADGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPEVSVFGHRTPLQITDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFATVFLMAGTMSTSQIVAAQDGVWYAFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMTTVSALAATLFFGGWHAPWPLNMWASANTGWWPLIWFTAKVWGFLFIYFWLRATLPRLRYDQFMALGWKLLIPVSLVWVMVAAIIRSLRNQGYQYWTPTLVFSSIVVAAAMVLLLRKPLSAPGARASARQRGDEGTSPEPAFPTPPLLAGATKENAGG

nuoH

NADH-quinone oxidoreductase subunit H

410 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 1 family.

44.895 kDa

MTYPDPTLFGHDPWWLILAKSLGVFVFLLLTVLAAILIERKILGRMQLRLGPNRVGPRGLLQSLADGIKLALKEGLVPAGVDKWIYLAAPVISVIPAFMAFAVIPLGPEVSVFGHRTALQLTDLPVAVLYILAVTSIGVYGIVLAGWASGSVYPLLGGLRSSAQVISYEIAMALSFVAVFIYAGTMSTSGIVAAQNDVWFIFLLLPSFLVYLTSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMTTVSALATTLFLGGWHAPWPISIADGANSDWWPLLWFTAKVWLFLFFFMWLRATLPRMRYDQFMRLGWKLLIPVSLAWIAIVATTRAMQNQGYQGWVTALIGVAGVAAILASLLAWRALRARRRRTSHSPPAQSSDHGAFPVPPLPVKEPADA

nuoH

NADH-quinone oxidoreductase subunit H

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 1 family.

44.971 kDa

MLGKALAIFVFLMLNVLVAILLERKILGWMQLRPGPNRVGPWGVLQSLADGIKLALKETITPGGVDKFVYFAAPVISTIPAFTAFAFIPFGPVVSVFGHRTPLQLTDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFAAVFLYAGSMSTSQIVAAQDRVWFVFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMMTVSSLATALFFGGWHAPWPLNMWAGANTGWWPVLWFTAKMWTFLFIYFWLRASLPRLRYDQFMGLGWKLLIPASLVWVLIAAVIRTLQNQGYAHWTPILVISSIVFAAALVLSLRKPFTTPHIRALRRQLRRKAKQLPTAPDSTPVFPTPPLPAKALAAASKEKARG

nuoH

NADH-quinone oxidoreductase subunit H

408 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

44.447 kDa

MTHPDPTLFGHDPWWLMLAKAVAIFVFLLLTVLSAILIERKLLGRMQMRFGPNRVGPAGLLQSLADGIKLALKEGLVPAGVDKPIYLLAPVISVIPAFVAFSVIPLGGAVSVFGHRTPLQLTDLPVAVLFILAATSIGVYGIVLAGWASGSTYPLLGGLRSSAQVVSYEIAMGLSFVAVFLYAGTMSTSGIVAAQDRTWFVFLLLPSFLVYVVSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMTTVSALATTMFLGGWHAPFPFNLIDGANSGWWPLLWFTAKVWTFMFLYFWLRATLPRLRYDQFMALGWKVLIPVSLLWIMVVAITRSLRQHGEGTWAAWLLTAAVVVVVALIWGLATSLRRRTVQPPPPQSTGAYPVPPLPSVGTKETADA

nuoH

NADH-quinone oxidoreductase subunit H

397 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

43.302 kDa

MPDWLSALLITLLKAVLVALALLTAFAYMTLIERRLLGRIQLRPGPNRVGPMGLLQPLADAIKSIFKEDVTVTLADKLVYTLAPILAIGMALTAFGGIPAGPPGSLFGTDPWVYNLDAGILALLALTSMGVYGIFLGGWASGSKYPMLGSLRSSAQMISYELGMGLSVLGLLMLVGSTNFLDIVEWQAGPRGHGWLILFQVFAFALFMVSSFAEVNRTPFDLPEAEQELVAGYLTEYSSIKWALFQMAEYVNIMTASALMSTLFFGGYRGPTFLEPLIPGISSWPLVWLIAKIAFFMFLFIWVRATLPRLRYDQLMRLGWKLTLPLALVNTLVVAAVLAFVPAEGLFGIPRLWLLGAVSLLLLLILFAASDAVRGLWNSPALRNEEKRVPGRPLGGD

nuoH

NADH-quinone oxidoreductase subunit H

390 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

42.769 kDa

MPDWLLTLLITVVKAVAVILALLTTFAYMTLVERKLLGRFQIRVGPNRVGPMGLLQPAADAIKSIFKEDLQVTLADKLVYTLAPIIAIGMALTAFGGIPAGPEGSLFGENPWVYNLDAGVLALLALTSMGVYGIFLGGWASGSKYPMLGGLRSSAQMISYELGMGLSILGLLMLVGSTRFTDIVLWQGANGWMILFQSLGFALFLISSFAETNRTPFDLVEAEQELVAGYLTEYSAIKWALFQMAEYVNMITASALMSTLFFGGWRGPGFLNGIIPGIADIPILWLVVKIGFFLFVFIWVRATLPRLRYDQLMRFGWKLLLPLALFNTMLVAGYIAFFSSWGWWPLALLSLLGLTALLALSDTVRQLWNAPMTRRETELPPVPTRSAGGD

nuoH

NADH-quinone oxidoreductase subunit H

389 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

42.569 kDa

MPDWLAQLLITLLKAVLVAFALLTTFAYMTLIERRLLARMQIRVGPNRVGPLGLLQPLADAIKSIFKEDLRVTLADKLVYTLAPIVAIGMALTAFGGIPAGPPKSLFGTDPWVYNLDAGILALLALTSMGVYGIFLGGWASGSKYPILGGLRSSAQMISYELGMGLSILGLLMLVGSTSFLRIVEWQALNGWLILFQLLGFALFLVSSFAETNRTPFDLPEAEQELVAGYLTEYSAIKWALFQMAEYVNMITASAVMATLFFGGYRGPVFLEGLIPGISGWPLIWLILKIACFLFLFIWVRATLPRLRYDQLMRFGWKLVLPVALANTLLTAAFLAFGRGAGLWLLGLLSLAGLLLLFALSDRVRALWNTPTQRRGAETAWVRPLGGDG

nuoH

NADH-quinone oxidoreductase subunit H

385 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

42.403 kDa

MGMGKDIFEITVNGLKLVVIFLMMVQAVPILVWLERRGSAFIQDRLGPNRVGPLGLVQLLADAVKFLNKENFMPQTAKPFLYYAAPIFALIPGAVAFSAIPLSSPIQVGTFEMFGSTWGPYTFLVQGYDIGVGIVFILGVSSLAAYTLLMAGWGSGNKYTLMGALRASAQTISYELALGLSIVGVIMLYGTFNLTEMTLAQQGPLAFSFLGHTITANWLPNWGIFYQPVGALLFFSAAFAESNRLPFDLAEGESELVGGFHTEYGGFKFNMFFIGEYGHMMIASGLMVLFFFGGYTIPYVSVAELNEWAAGVASTAGKASALVALIHFLVFNIKFGFFMWVFIWVRWTLPRFRYDQLMDLGWKTMLPWALANTIITAFVIYIASL

nuoH

NADH-quinone oxidoreductase subunit H

372 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

41.048 kDa

MTVTALSQLSLPLFMGTTLNAWSDALAGFTPWGLPVGLLIIAAIPLVFIALYALTYGVYGERKISAFMQDRLGPMEVGKWGILQTLADILKLLQKEDIVPLSADKFLFVIGPGVLFVGSFLAFAVLPFSPAFIGASLNVGLFYAVGIVALEVVGILAAGWGSNNKWSLYGAVRSVAQIVSYEIPASIALLCGAMMAGTLDMQKITILQSGELGFAHFYLFQNPIAWLPFLIYFIASLAETNRAPFDIPEAESELVAGYFTEYSGMKFAVIFLAEYGRMFMVSAIISIVFLGGWNSPLPNIGAFELNTWTSGAVWGAFWIIMKGFFFIFVQMWLRWTLPRLRVDQLMYLCWKVLTPFAFVSFVLTALWEIYVP

nuoH

NADH-quinone oxidoreductase subunit H

372 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.793 kDa

MSFNALPQSSMPLLMGNSLNAWSDALTGFAPMGLPLGLLVIAAIPLVFIALYALTYGVYGERKISAFMQDRLGPMEVGKWGILQTLADILKLLQKEDIVPTSADKFLFVIGPGVLFVGSFLAFAVLPFGPAFIGANLNVGLFYAIGIVALEVVGILAAGWGSNNKWALYGAVRSVAQIVSYEIPAAIALLCGAMMAGTLDMQEINVLQSGPWGFAHFFLFQSPIAWLPFLIYFIASLAETNRAPFDIPEAESELVAGYFTEYSGMKFAVIFLAEYGSMFMVSAIIAIVFLGGWNSPLPNIGSLALNDLTTGPVWGAFWIIMKGFFFIFVQMWLRWTLPRLRVDQLMYLCWKVLTPFAFVSFVLTAIWMIYVP

nuoH

NADH-quinone oxidoreductase subunit H

372 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.847 kDa

MSVMALSQIRIPLLMGNSLNAWSEALTGFSIWGFPLGLVILAAIPLVFIALYALTYGVYGERKISAFMQDRLGPMEVGKWGILQTLADILKLLQKEDIVPAAADKFLFVVGPGILFVGSFLAFAVLPFSSAFIGANLNVGLFYAIGIVSIEVVGILAAGWGSNNKWSLYGAVRSVAQIVSYEIPAGIALLCGAMMAGTLDMQQITMLQSGHLGFAHFNLFQSPIAWLPFLIYFIASLAEVNRAPFDIPEAESELVAGYFTEYSGMKFAVIFLAEYGSMFMVSAVLSIVFLGGWNSPLPDLGPVSLNAMTSGPVWGVFWIISKGFFFIFVQMWLRWTLPRLRVDQLMYLCWKVLTPFAFIGFVLTAIWEIYVP

nuoH

NADH-quinone oxidoreductase subunit H

369 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

41.223 kDa

MSYYYNIFTDFISCISSGAVLLIKIMAVIISVMVSVAYLVYMERKVIGAIQLRQGPNVVGPFGLLQPFADAVKLIIKEHIIPFKSNKICFLIAPIITFTLALLGWAVIPFGADVIVNNGHEVIIPNVIANINIGVLYILAISSLGVYGIIIAGWSSNSNYAFLGAIRSASQMISYEVSIGLTIVTVLLATGSLKLGEIVVARHNMPYWIDLLLLPMACVFFISSLAETNRHPFDLPEAESELVSGYNVEYSSMPFALFFLGEYANMILINAMAVIFFFGGWYPPLNISFLYVIPGIIWFVLKIIVLLFCFIWIRATIPRYRYDQLMRLGWKVFLPISLLWVVLVSGVLLYTDSLPRNAYGIQYVHDLDQ

nuoH

NADH-quinone oxidoreductase subunit H

367 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.812 kDa

MSYYNIFLDFLSYIGSGAALFIKIIAVIISVMISVAYLVYMERKVIAAIQLRQGPNVVGPFGLLQPFADAVKLIIKEHIIPFKSNKICFLIAPIITFTLALLGWAVIPFGADVIVNDGYEVIIPNAIANINIGVLYILAISSLGVYGIIIAGWSSNSNYAFLGAIRSASQMISYEVSIGLTIVTVLLATGSLKLGEIVVARHNMPYWIDLLLLPMACIFFISALAETNRHPFDLPEAESELVSGYNVEYSSMPFALFFLGEYANMILINAMAVIFFFGGWYPPLNIGFLYIIPGIVWFVLKVVALLFCFIWIRATIPRYRYDQLMGLGWKVFLPISLLWVVLVSSILVYTDSLPSNNKQYVSHAMHK

nuoH

NADH-quinone oxidoreductase subunit H

367 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

41.327 kDa

MHNYNIFLSFYNYISSGVLLFLKIIIVIISVMVSVAYLVYMERKVIAAIQLRQGPSVVGPFGLLQPFADAIKLIIKEPIIPFKANKLCFLIAPVITFTLALLGWAVIPFGSYIIVDNGQELIVPNVIANINIGVLYILAISSLGVYGIIIAGWSSNSNYAFLGAIRSASQMISYEVSIGLTIVTVLLATGSLKLGEIVIARHNMPYWIDLLLLPMAFMFFISALAETNRHPFDLPEAESELVSGYNVEYSSMPFALFFLGEYANMILMSAMAVIFFFGGWYPPLNVSFLYIIPGTIWFIFKIVILLFCFIWIRASIPRYRYDQLMRLGWKVFLPISLFWVILVSGILVYTDSLPKNTLNNTVYYKEN

nuoH

NADH-quinone oxidoreductase subunit H

367 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

41.327 kDa

MHNYNIFLSFYNYISSGVLLFLKIIIVIISVMVSVAYLVYMERKVIAAIQLRQGPSVVGPFGLLQPFADAIKLIIKEPIIPFKANKLCFLIAPVITFTLALLGWAVIPFGSYIIVDNGQELIVPNVIANINIGVLYILAISSLGVYGIIIAGWSSNSNYAFLGAIRSASQMISYEVSIGLTIVTVLLATGSLKLGEIVIARHNMPYWIDLLLLPMAFMFFISALAETNRHPFDLPEAESELVSGYNVEYSSMPFALFFLGEYANMILMSAMAVIFFFGGWYPPLNVSFLYIIPGTIWFIFKIVILLFCFIWIRASIPRYRYDQLMRLGWKVFLPISLFWVILVSGILVYTDSLPKNTLNNTVYYKEN

nuoH

NADH-quinone oxidoreductase subunit H

366 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.726 kDa

MDSLQPLFEQLFGSEWGGPLFLLIKNLLLILAIVIPLLLAVAYLTFAERKIIAYMQVRVGPNRVTFFDIPWLRGWGQPIADAVKAIMKEIIIPTGANKFLFLLAPVLAIGPALAAWAVVPFSPELVLADINAGLLYILAMTSLGVYGVIIAGWASNSKYAFLGAMRSAAQVVSYELAMGFALVCVLMMSSSLNLGDIVAGQQGGSFLNWYLIPLFPMFLVYFISGVAETNRAPFDVAEGESEIVAGFHVDYSGMAFTVFFLAEYANMILVATLASIMFLGGWLPPVDIAPFNLIPGMVWLLLKIAFMLFFFLWFRATFPRYRYDQIMRLGWKVFIPLTLVWIVVLGMVMQLPEVVRQSFPLNLWFN

nuoH

NADH-quinone oxidoreductase subunit H

365 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

41.009 kDa

MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRFLFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLISYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIKWALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKLAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLWFLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA

nuoH

NADH-quinone oxidoreductase subunit H

365 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.482 kDa

MDSFQPLFEQLFGSEWGVSLFLLAKNLLLILAIIIPLLLAVAYLTFAERKIIAFMQVRVGPNRVTFFGIPWLGGWGQPIADAVKAIMKEIIIPTGANKFLFLLAPILAITPALAAWAVVPFSPELVLADINAALLYILAMTSLGVYGVIIAGWASNSKYAFLGAMRSAAQVISYELAMGFALVCVLMMSSSLNLGDIVAGQQGGSFLNWYMIPLFPMFLVYFISGVAETNRLPFDVAEGESEIVAGFHVDYSGMAFTIFFLAEYANMILVATLASIMFLGGWLPPVDIIPFNLIPGVVWLLLKIAIMLFFFLWFRATFPRYRYDQIMRLGWKVFIPITLIWIVLLGAVMQLPEAALQSFPLNLWF

nuoH

NADH-quinone oxidoreductase subunit H

364 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.505 kDa

MSNAIESLGSLWGPLLVLGQIGLFTLVLLLSIAFLLLLDRKVWAGVMMRKGPNVVGPFGLLQSFADFGKFLLKEIVIPAGANKAVFILAPILTCTLAFVTWAAIPVAPGTATGTSWVIANLNVGVLYLFAISSLGVYGIIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVILLVGSMNLTTIVNNQDGGIQNWHVFSFQYFPLIVVMVPMFVIFFISALAETNRPPFDLPEAESELVAGYQVEYGSTPYLLFMLGEYLNIVLMCAMMTILFLGGWHGPISLGPELTANLPPLLLSLSGLAWFMGKVLFCFFLFALVKAIVPRYRYDQLMRLGWKIFLPTSLAAVIIVAGYVTFVGGLS

nuoH

NADH-quinone oxidoreductase subunit H

364 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.974 kDa

MMDPAATSFWATPVGWTLVTAGQILAVMIWILLSLAFLLLADRKIWAGVQMRKGPNVVGPFGLLQSFADFLKFVLKEIVIPSGADKTVFLLAPLISFTLAFAAWAVIPLAPGWVVSDINVGILYLFAISSLGVYGIIMGGWASNSKYPFLGSLRSAAQMVSYEVSIGFIIITVILLAGSMNLQQIVASQTGGFWNWYVFGGPGGLAKLPLLLVMVPMAVIFFISGLAETNRPPFDLPEAESELVAGYQVEYSSTPYLLFMIGEYANIVLICAMTTILFFGGWSAPFPSDFTDSWAPTAASFYYFMWFFLKVIFFFFLVSMAKAIVPRYRYDQLMRLGWKVFLPFSLVCVALIAAWRVFGPAAAA

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.449 kDa

MNELLLNLVDPLHQWFLGLGDGGAVLWSVLKILLIAVPVIVTVAFYVVWERKLIGWMHVRHGPMYVGMGIFQAFADVFKLLFKEIVQPASSHKAMFVIAPLLTLAPAFAAWSVVPFDAKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIASGSVNLSQIVFAQAGNSGFFDWFLIPLFPLFIVYWVSGVAETNRAPFDVVEGESEIVAGHMVEYSGGAFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVNADISPWIDWLWKGGWPWLLMKVFFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFYGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.463 kDa

MNELLLNLVDPLHQWFLGLGDGGVVLWSVLKILLIAVPVIVAVAFYVVWERKLIGWMHVRHGPMYVGMGIFQAFADVFKLLFKEIVQPTSSHKAMFVIAPLLTLAPAFAAWSVVPFDAKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIASGSVNLSQIVFAQAGNSGFFDWFLIPLFPLFIVYWVSGVAETNRAPFDVVEGESEIVAGHMVEYSGGAFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVNADVSPWIDWLWKGGWPWLLMKVFFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFYGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.453 kDa

MNELLLNVVDPLHQWFLGLGDGGVLLWTVLKILLIAVPVIVTVAFYVVWERKLIGWMHVRHGPMYVGMGIFQAFADVFKLLFKEILQPSSSHKAMFIIAPLLTLAPAFAAWSVVPFDAKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIASGSVNLSQIVFAQAGSSGFFDWFLIPLFPLFIVYWVSGVAETNRAPFDVVEGESEIVAGHMVEYSGGAFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVTADISPWVNWLWTGGWPWLLMKVFFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFYGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.439 kDa

MNELLLNVVDPLHQWFLGLGDGGVLLWTVLKILLIAVPVIVTVAFYVVWERKLIGWMHVRHGPMYVGMGIFQAFADVFKLLFKEILQPSSSHKAMFIIAPLLTLAPAFAAWSVVPFDAKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIASGSVNLSQIVFAQAGSSGFFDWFLIPLFPLFIVYWVSGVAETNRAPFDVVEGESEIVAGHMVEYSGGAFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVTADVSPWVNWLWTGGWPWLLMKVFFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFYGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.453 kDa

MNELLLNVVDPLHQWFLGLGDGGVLLWTVLKILLIAVPVIVTVAFYVVWERKLIGWMHVRHGPMYVGMGIFQAFADVFKLLFKEILQPSSSHKAMFIIAPLLTLAPAFAAWSVVPFDAKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIASGSVNLSQIVFAQAGSSGFFDWFLIPLFPLFIVYWVSGVAETNRAPFDVVEGESEIVAGHMVEYSGGAFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVTADISPWVNWLWTGGWPWLLMKVFFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFYGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.541 kDa

MNELLLNLVDPLHQWFLGLGDGGVVLWSVLKILLIAVPVIVSVAFYVVWERKLIGWMHVRHGPMYVGMGIFQAFADVFKLLFKEILQPSSSHKAMFIIAPLLTLAPAFAAWSVVPFDAKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIASGSVNLSQIVFAQAGNSGFFDWFLIPLFPLFIVYWVSGVAETNRAPFDVVEGESEIVAGHMVEYSGGAFALFFLAEYANMILVSFLISIFFFGGWLSPIQGWVNADISPWIDWLWKGGWPWLLMKVFFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFYGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.507 kDa

MNELLLNLVDPLHQWFLGLGDGGVVLWSVLKILLIAVPVIVSVAFYVVWERKLIGWMHVRHGPMYVGMGIFQAFADVFKLLFKEILQPSSSHKAMFIIAPLLTLAPAFAAWSVVPFDAKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIASGSVNLSQIVFAQAGNSGFFDWFLIPLFPLFIVYWVSGVAETNRAPFDVVEGESEIVAGHMVEYSGGAFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVNADISPWIDWLWKGGWPWLLMKVFFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFYGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.507 kDa

MNELLLNLVDPLHQWFLGLGDGGVVLWSVLKILLIAVPVIVSVAFYVVWERKLIGWMHVRHGPMYVGMGIFQAFADVFKLLFKEILQPSSSHKAMFIIAPLLTLAPAFAAWSVVPFDAKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIASGSVNLSQIVFAQAGNSGFFDWFLIPLFPLFIVYWVSGVAETNRAPFDVVEGESEIVAGHMVEYSGGAFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVNADISPWIDWLWKGGWPWLLMKVFFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFYGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.524 kDa

MNTWFLNVVDPLHQWFLGFGDIGVVLWTVLKILMIAIPLIVSVAFYVVWERKLIGWMHVRHGPMYVGMGLFQAFADVFKLLFKEVLYPSKAHKAIFVIAPLLTLAPSFAAWAVVPFDTKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIAAGSLNLSQIVMAQAGSSGFFDWFLIPLFPLFIVYWVSGVAETNRSPFDVVEGESEIVAGHMVEYSGSVFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVSGQVSPLIDWVWNGGWPWLLLKVLFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFSGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.558 kDa

MNTWFLNVVDPLHQWFLGFGDIGVVLWTVLKILMIAIPLIVSVAFYVVWERKLIGWMHVRHGPMYVGMGLFQAFADVFKLLFKEVLYPSKAHKAIFVIAPLLTLAPSFAAWAVVPFDTKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIAAGSLNLSQIVMAQAGSSGFFDWFLIPLFPLFIVYWVSGVAETNRSPFDVVEGESEIVAGHMVEYSGSVFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVSGQVSPLIDWVWNGGWPWLLFKVLFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFSGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.552 kDa

MNTWFLNVVDPLHQWFLGFGDIGVVLWTVLKILMIAIPLIVSVAFYVVWERKLIGWMHVRHGPMYVGMGLFQAFADVFKLLFKEVLYPSKAHKVIFVIAPLLTLAPSFAAWAVVPFDTKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIAAGSLNLSQIVMAQAGSSGFFDWFLIPLFPLFIVYWVSGVAETNRSPFDVVEGESEIVAGHMVEYSGSVFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVSGQVSPLIDWVWNGGWPWLLLKVLFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFSGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

363 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.524 kDa

MNTWFLNVVDPLHQWFLGFGDIGVVLWTVLKILMIAIPLIVSVAFYVVWERKLIGWMHVRHGPMYVGMGLFQAFADVFKLLFKEVLYPSKAHKAIFVIAPLLTLAPSFAAWAVVPFDTKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVMIAAGSLNLSQIVMAQAGSSGFFDWFLIPLFPLFIVYWVSGVAETNRSPFDVVEGESEIVAGHMVEYSGSVFALFFLAEYANMILVSFLISIFFLGGWLSPIQGWVSGQVSPLIDWVWNGGWPWLLLKVLFFASAYIWFRASFPRYRYDQIMRLGWKVFIPLTIVWIAVTALMVFSGVIQKGV

nuoH

NADH-quinone oxidoreductase subunit H

360 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.568 kDa

MIDALYQAGLQLLPGGWWTGMVWPVLWILLKIVALLIPLMGAVAYLTLWERKLLGFMQVRHGPNRVGPWGLLQPIADALKLLTKEIIQPTAASRGLFVLGPVMAIMPALAAWVVIPFGPDVALANVNAGLLLVMAITSIEVYGVIIAGWASNSKYAFLGALRASAQMVSYEIAMGFCLLIVIMVSGSMNLTEIVLAQGRGVAAANGIGFLSWNWLPLLPVFLVYLISGVAETNRHPFDVVEGEAEIVAGHMVEYSGMGFAIFFLAEYASMWLVSILAALMFLGGWLPPVDSASLHWIPGWIWLGIKTCLVVSMFIWIRATFPRFRYDQIMRLGWKIFIPVTLACLLIAGGWLLSPWNIWK

nuoH

NADH-quinone oxidoreductase subunit H

360 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.172 kDa

MIMQEWFQNLFAATLGLGDLGITVGLVVSVIVKIVIILIPLILTVAYLTYFERKVIGFMQLRVGPNVTGPWGLIQPFADVFKLLFKEVTRPKLSNKALFYIGPIMSLAPSFAAWAVIPFNEEWVLTNINIGLLYILMITSLSVYGVIIAGWASNSKYSFLGAMRASAQSISYEIAMSAALVCVVMVSGSMNFSDIVAAQAKGIAGGSVFSWNWLPLFPIFIVYLISAVAETNRAPFDVAEGESEIVAGHHVEYSGFAFALFFLAEYIFMILIAALTSLMFLGGWLSPFPQSWGFIGTPSAFWMFVKMAAVLYWYLWIRATFPRYRYDQIMRLGWKVLIPIGFAYIVILGVWMISPLNLWK

nuoH

NADH-quinone oxidoreductase subunit H

360 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.552 kDa

MIDTIFALGEGLLAAPWWSAIGWPVVWALIKVTLVLMIVMGAVTYTTLWERRLLAWAQIRMGPNRVGPWGLLQPIADAMKLMTKEVLRPAAAEKFLFYLGPVMTVMPAMAAWAVIPFGPDIALANINAGLLFLMAITSMEVYGVIISGWSSNSKYPFLGALRASSQMVSYEIAMGFCLVVVLMVSASLNLTDIVAGQNKGYFAQIGLNFLSWNWLPLLPIFLIYFISGLAETNRLPFDVIEGESEIVAGHMVEYSGMSWAMFQMAEYANIWLVSVLTTIMFLGGWLSPIDSVMFNWIPGWIWLGLKSFCVVTMFIWVRVSFPRFRYDQIMRLGWKIFIPVSLIWLVVVGGWMQTPWNIWK

nuoH

NADH-quinone oxidoreductase subunit H

359 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.497 kDa

MSSSPSLNTWSDALSGLSIGWFPLGLVIIAAIPLVFIALYALTYGVYGERKISAFMQDRLGPMEVGIWGLLQTLADILKLLQKEDIVPKLADKFLFVIGPGILFVGSFLAFAVLPFGPAFIGADLNVGLFYAVGIVAIEVVGILAAGWGSNNKWALYGAVRSVAQIVSYEIPASIALLCAAMLAGTLSMQQITMMQAGPGGFMHWFLFTNPIAWLPFLIYFISSLAETNRAPFDIPEAESELVAGYFTEYSGMKFAVIFLAEYGRMFMVSAIISIAFLGGWTSPLPNIGGLELNTMTSGPVWGAFWIIMKGFFFIFVQMWLRWTLPRLRVDQLMYLCWKVLTPFSLIAFVLTAIWVINH

nuoH

NADH-quinone oxidoreductase subunit H

359 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.476 kDa

MSSSPSLNTWSDALSGFSIGWFPLGLVIVAAIPLVFIALYALTYGVYGERKISAFMQDRLGPMEVGFWGLLQTLADILKLLQKEDIVPTVADKFLFVIGPGILFVGSFLAFAVLPFGPAFIGADLNVGLFYAVGIVAIEVVGILAAGWGSNNKWALYGAVRSVAQIVSYEIPASIALLCAAMLAGTLSMQQIILMQAGPNGFLHWFLFTNPIAWLPFLIYFISSLAETNRAPFDIPEAESELVAGYFTEYSGMKFAVIFLAEYGSMFMVSAIISIAFLGGWTSPLPNIGGLELNTMTSGPVWGAFWIIMKGFFFIFVQMWLRWTLPRLRVDQLMYLCWKVLTPFSLVSFVLTAIWVINH

nuoH

NADH-quinone oxidoreductase subunit H

359 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.555 kDa

MIDAMYATGQGLMGGIWPATVWPVLWVLIKIVAVLAPLMGCVAYLTLWERKAIGFTQVRVGPNRIGPFGLLQPIADALKLLTKEIIIPTAASKGLFILGPIMTIMPALAAWAVIPFGPDVALANVNAGLLFIMAITSLEVYGVIIAGWGSNSKYAFLGAMRASAQMVSYEIAMGFCLVVVLMVSGSLNMTDIVMSQGSGMAASKGLTFLSWNWLPLLPIFVVYFISSLAETNRHPFDVVEGESEIVAGHMVEYSGMSFAMFFLAEYANMILVSVLCVLLFLGGWLSPIDSALFTWIPGWIWLGLKTFVVVTIFLWVRSTFPRFRYDQIMRLGWKIFIPVTLVWLVVVGAWMQTPYNIWK

nuoH

NADH-quinone oxidoreductase subunit H

359 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.949 kDa

MIDTVYGFGQGLMGGIWPATVWPVLWALIKIVCVLLPLMGCVAYLTLWERKAIGFTQIRFGPNRVGPFGLLQPIADALKLLTKEIIMPTAASKGLFVLGPIMTIMPALAAWAVIPFGPDIALSNINAGLLFLMAITSMEVYGVIIAGWASNSKYAFLGAMRASAQMVSYEIAMGFCLVVVLMVSASLNMTDIVMSQAKGIAVGYGLNFLSWNWLPLLPIFVVYFISGLAETNRHPFDVVEGESEIVAGHMVEYSGMAFAMFFLAEYANMWLVAILAVILFLGGWLSPVDWWLFNLIPGWIWLGAKTFVVVTMFLWVRATFPRFRYDQIMRLGWKIFIPVTLVWLVVVGAWMQTPYNIWK

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.369 kDa

MIDALYNGGLNLVAQSWWTGAVWPVLWNLLKIVAIVAPLMGAVAYLTLWERKLLGFMQVRHGPNRVGPFGLLQPLADGLKLLTKEIIQPAAASKGLFVLGPVMAIMPALAAWVAIPFGPDVALANVNAGLLLIMAITSIEVYGVIIAGWASNSKYAFLGALRASAQMVSYEIAMGFCFLVVIMVSGSMNLTQIVLSQAQGTMANAGLSFLSWNWLPLLPIFIVYLISGVAETNRHPFDVVEGEAEIVAGHMVEYSGMGFAIFFLAEYASMWLVSILGVTMFLGGWLSPVAALDFIPGWIWLGLKTFLVVSMFIWIRATFPRFRYDQIMRLGWKIFIPVTLVWLLIVGGWLLSPWNIWK

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.575 kDa

MIDAIYNGGLNLVAASWWTGAAWPVIWNLIKIICVVLPLLGAVAYLTLWERKLLGFMQVRFGPNRVGPFGLLQPIADALKLLTKELIQPAAAAKGLFYLGPVMAIMPALGAWAVIPFGPDLALANVNAGLLLVMAITSIEVYGVIIAGWASNSKYAFLGALRASAQMVSYEIAMGFCFLVVIMVSGSMNLTEIVAVQGRGTMTDMGLGFLSWNWLPLFPIFIVYLISVVAEVNRHPFDVVEGEAEIVAGHMVEYSGMGFAIFFLAEYASMWLVSILAVVMFLGGWLPPFDALGFIPGWIWLGIKTFLVVSMFIWIRATFPRFRYDQIMRLGWKIFIPVTLVWLLVVGAWLLSPWNIWK

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.835 kDa

MQEWFQNLFAATLGLGDLGITVGLVVSVIVKIVIILIPLILTVAYLTYFERKVIGFMQLRVGPNVTGPRGLIQPFADVFKLLFKEVTRPKLSNKALFYIGPIMSLAPSFAAWAVIPFNEEWVLTNINIGLLYILMITSLSVYGVIIAGWASNSKYSFLGAMRASAQSISYEIAMSAALVCVVMVSGSMNFSDIVAAQAKGIAGGSVFSWNWLPLFPIFIVYLISAVAETNRAPFDVAEGESEIVAGHHVEYSGFAFALFFLAEYIFMILIAALTSLMFLGGWLSPFPQSWGIVGTPSAFWMFVKMAAVLYWYLWIRATFPRYRYDQIMRLGWKVLIPIGFAYIVVLGVWMISPLNLWK

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.958 kDa

MQEWFQNLFAATLGLGDLGITVGLVVSVIVKIVIILIPLILTVAYLTYFERKVIGFMQLRVGPNVTGPWGLIQPFADVFKLLFKEVTRPRLSNKALFYIGPIMSLAPSFAAWAVIPFNEEWVLTNINIGLLYILMITSLSVYGVIIAGWASNSKYSFLGAMRASAQSISYEIAMSAALVCVVMVSGSMNFSDIVAAQAKGIAGGSVFSWNWLPLFPIFIVYLISAVAETNRAPFDVAEGESEIVAGHHVEYSGFAFALFFLAEYIFMILISALTSLMFLGGWLSPFPQSWGFIGTPSAFWMFVKMAAVLYWYLWIRATFPRYRYDQIMRLGWKVLIPIGFAYIVVLGVWMISPLNLWK

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.986 kDa

MQEWFQNLFAATLGLGDLGITVGLVVSVIVKIVIILIPLILTVAYLTYFERKVIGFMQLRVGPNVTGPWGLIQPFADVFKLLFKEVTRPRLSNKALFYIGPIMSLAPSFAAWAVIPFNEEWVLTNINIGLLYILMITSLSVYGVIIAGWASNSKYSFLGAMRASAQSISYEIAMSAALVCVVMVSGSMNFSDIVAAQAKGIAGGSVFSWNWLPLFPIFIVYLISAVAETNRAPFDVAEGESEIVAGHHVEYSGFAFALFFLAEYIFMILISALTSLMFLGGWLSPFPQSWGFIGTPSAFWMFVKMAAVLYWYLWIRATFPRYRYDQIMRLGWKVLIPIGFAYIVILGLWMISPLNLWK

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.851 kDa

MQEWFQNLFAATLGLGDLGITVGLVVSVIVKIVIILIPLILTVAYLTYFERKVIGFMQLRVGPNVTGPWGLIQPFADVFKLLFKEVTRPKLSNKALFYIGPIMSLAPSFAAWAVIPFNEEWVLTNINIGLLYILMITSLSVYGVIIAGWASNSKYSFLGAMRASAQSISYEIAMSAALVCVVMVSGSMNFSDIVAAQAKGIAGGSVFSWNWLPLFPIFIVYLISAVAETNRAPFDVAEGESEIVAGHHVEYSGFAFALFFLAEYIFMILIAALTSLMFLGGWLSPFPQSWGIVGTPSAFWMFAKMAAVLYWYLWIRATFPRYRYDQIMRLGWKVLIPIGFAYIVILGVWMISPLNLWK

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.059 kDa

MFDFSIITSWIHQTLTSVMPEGLAVFIECVVIGVCIVALYAILAILLIYMERKVCGFFQCRLGPNRVGKWGSIQVLCDVLKMLTKEIIELKHSDKFLYNLAPFMVIIASFLTFSCLPISKGLEVLDFNVGVFFLLAASSIGVVGILLAGWGSNNKFSLIGAMRSGAQIISYELSVGLSILTMVVLMGTMQFSEIVESQANGWFIFKGHIPALIAFVIYLIAGNAECNRGPFDLPEAESELTAGYHTEYSGMHFGFFYLAEYLNMFIVAAVAATIFLGGWMPLHIVGLDGFNAVMDYIPGFIWFFGKAFFVVFLLMWIKWTFPRLRIDQILNLEWKYLVPISMVNLVIMVLIVVFGLHF

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.059 kDa

MFDFSIITSWIHQTLTSVMPEGLAVFIECVVIGVCIVALYAILAILLIYMERKVCGFFQCRLGPNRVGKWGSIQVLCDVLKMLTKEIIELKHSDKFLYNLAPFMVIIASFLTFSCLPISKGLEVLDFNVGVFFLLAASSIGVVGILLAGWGSNNKFSLIGAMRSGAQIISYELSVGLSILTMVVLMGTMQFSEIVESQANGWFIFKGHIPALIAFVIYLIAGNAECNRGPFDLPEAESELTAGYHTEYSGMHFGFFYLAEYLNMFIVAAVAATIFLGGWMPLHIVGLDGFNAVMDYIPGFIWFFGKAFFVVFLLMWIKWTFPRLRIDQILNLEWKYLVPISMVNLVIMVLIVVFGLHF

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.161 kDa

MFDFSIVTNWIHEMLLSVMPEGWAIFIECIAVGVCIVALYAILAIVLIYMERKVCGFFQCRLGPNRVGKWGSIQVICDVLKMLTKEIFTPKDADRFLYNLAPFMVIIASFLTFACIPFNKGAEILNFNVGVFFLLAASSIGVVGILLAGWGSNNKFSLIGAMRSGAQIISYELSVGMSIMTMVVLMGTMQFSEIVEGQADGWFIFKGHIPAVIAFIIYLIAGNAECNRGPFDLPEAESELTAGYHTEYSGMHFGFFYLAEYLNLFIVASVAATIFLGGWMPLHIIGLDGFNAVMDYIPGFIWFFAKAFFVVFLLMWIKWTFPRLRIDQILNLEWKYLVPISMVNLLLMACCVAFGFHF

nuoH

NADH-quinone oxidoreductase subunit H

358 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.263 kDa

MFDFSIVTQWVHSLLTSFMPEELAVLIECIVIGVCIMLAYAVIAIIMIFMERKVCAAFQCRLGPMRVGPQGTIQVFADVFKMLIKEIITIRHADKFLYNLAPYIVILASIMAFSCLPINKGMEVLDFNVGIFFLLAASSIGVVGILLAGWSSNNKYSLIGAMRSGAQMISYELSVGLSILTIVILTDTMQLSEIVERQADGWFLFKGHIPALIAFIIYLIAGNAEVNRGPFDLPEAESELTAGYHTEYSGMHFGLFYVAEFVNLFIIAAVATTIFLGGWMPLHIPGLDGFNAIMDYIPGFIWFFGKSFFVVWLLMWIKWTFPRLRIDQILTLEWKYLVPIGLCNLLLMVIIVVFKLHF

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.31 kDa

MELWQTFVKMVHALVPWLDGTVAIILIIFIKAIALLIPLMLVVAYFTYAERKVIGYMQLRIGPNRVGPKGWLQPIADALKLMTKEIIFPTKANIYLFLLAPVLAIAPAIAVWAVIPFDESIYITNLDISLLYVLAIGSIGVYGIILAGWASNSKYPLLGALRSAALLVSYEIVIGFALVTVVMIAGSVNLNTIVQAQQGGIIYWYFIPLFPIMIIFFISSLVETNRAPFDVVEGESEIVGGTHVEYSGMTFAVFFLAEYANMILMAVLSVIMFFGGWHSPFEAIPYLESVFSWIPGMIWLLAKTTFFMFLYLWVRATFPRFRYDQIMHLSWKVFLPITIIWIFVVALMTQLQLSPWF

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.025 kDa

MEWLNVLESQGQALLGPTAWLVVWTIIKIVIIAVPIILCVAYLTYWERKMIGWMHVRLGPNRVGFKGLLQPFADVFKLLTKEVVVPSQANKILFIVAPVVTLMPALAAWAVVPFGPEAVLANVNAGLLYVMAITSIGVYGVIVAGWASNSKYAFLGALRASAQMVSYELAISFVLVTVLLVSGSLNMNEIVLGQGRGWFAERGLTFLSWNWLPLLPLFVIYVISAVAETNRHPFDVVEGESEIVAGHMVEYSGMAFALFFLGEYANMILLSAMASIMFLGGWMSPIDIAPLNWIPGWIWLGIKTFFVVSLFIWFRASFPRYRYDQIMRLGWKIFIPLTGVWLVVVAIWMQTPWNIWR

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.77 kDa

MEWLNVLESHGQALLGPVAWMVVWSLVKIVVIAVPIILCVAYLTYWERKMIGAMHVRLGPTRVGFKGLLQPFADVFKLLTKEVVVPSAANKVLFVVAPVVTLMPALAAWAVVPFGPEVVLANVNAGLLYIMAITSIGVYGVIVAGWASNSKYAFLGALRASAQMVSYELAIGFVLVSVLLVSGSLNMSEIVLGQGRGWFAERGLTFLSWNWLPLLPLFIIYVISAVAETNRHPFDVVEGESEIVAGHMVEYSGMAFALFFLGEYANMILLSCMAAIMFLGGWMSPIDIAPLNWIPGWIWLGIKTFCVVSMFVWFRASFPRYRYDQIMRLGWKIFIPLTGVWLVVLAIWMQTPWNIWR

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.77 kDa

MEWLNVLESHGQALLGPVAWMVVWSLVKIVVIAVPIILCVAYLTYWERKMIGAMHVRLGPTRVGFKGLLQPFADVFKLLTKEVVVPSAANKVLFVVAPVVTLMPALAAWAVVPFGPEVVLANVNAGLLYIMAITSIGVYGVIVAGWASNSKYAFLGALRASAQMVSYELAIGFVLVSVLLVSGSLNMSEIVLGQGRGWFAERGLTFLSWNWLPLLPLFIIYVISAVAETNRHPFDVVEGESEIVAGHMVEYSGMAFALFFLGEYANMILLSCMAAIMFLGGWMSPIDIAPLNWIPGWIWLGIKTFCVVSMFVWFRASFPRYRYDQIMRLGWKIFIPLTGVWLVVLAIWMQTPWNIWR

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.977 kDa

MEWLDILESHGQALLGPTAWLVLWTIVKIVVIAVPIILCVAYLTYWERKMIGWMHVRLGPTRVGFRGLLQPFADVFKLLTKEVVVPTQANKILFVVAPVVTLMPALAAWAVVPFGPEVVLANVNAGLLYVMAITSIGVYGVIVAGWASNSKYAFLGALRASAQMVSYELAIGFVLVTVLLVSGSLNMSEIVLGQTRGWFAEHGLTFLSWNWLPLLPLFVIYVISAVAETNRHPFDVVEGESEIVAGHMVEYSGMAFALFFLGEYANMILLSCMASIMFLGGWTSPIDIAPLTWIPGWIWLGIKTFCVVSLFVWFRASFPRYRYDQIMRLGWKIFIPLTGVWLVVVAIWMQTPWNIWR

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.77 kDa

MEWLNVLESHGQALLGPVAWMVVWSLVKIVVIAVPIILCVAYLTYWERKMIGAMHVRLGPTRVGFKGLLQPFADVFKLLTKEVVVPSAANKVLFVVAPVVTLMPALAAWAVVPFGPEVVLANVNAGLLYIMAITSIGVYGVIVAGWASNSKYAFLGALRASAQMVSYELAIGFVLVSVLLVSGSLNMSEIVLGQGRGWFAERGLTFLSWNWLPLLPLFIIYVISAVAETNRHPFDVVEGESEIVAGHMVEYSGMAFALFFLGEYANMILLSCMAAIMFLGGWMSPIDIAPLNWIPGWIWLGIKTFCVVSMFVWFRASFPRYRYDQIMRLGWKIFIPLTGVWLVVLAIWMQTPWNIWR

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.323 kDa

MELWQAFVQMVYTLTPWFDGTIASILIILIKAITLVIPLMLVVAYFTYAERKVIGYMQLRIGPNRVGPKGWLQPIADALKLMTKEIIFPTKANIYLFLLAPVLAIAPAIAVWVVIPFDEDIYITNLDISLLYVLAIGSIGVYGIILAGWASNSKYPLLGALRSASLLVSYEIVIGFALATVVMIAGSVNLNTIVQAQQGGIIYWNFIPLFPMMIIFFISALIETNRAPFDVVEGESEIVGGTHVEYSGMTFAVFFLAEYANMILMAVLAVVMFFGGWHSPFEAIPYLESAFSWVPGIIWLLAKTTFFMFLYLWVRATFPRFRYDQIMRLSWKVFLPITIIWIFVVALMTQLKLEPWF

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.876 kDa

MDQLLASVHAAGHSFLGDYWLLVWTLVKIVAVVLPLMGCVAYLTLWERKVIGWMHVRHGPNRTGPAGLLQPIADALKLLLKEIVVPAKSSKALFVIAPIMTIMPALAAWAVIPFGPEAALANVNAGLLFVMAITSLEVYGVIVAGWASNSKYAFLGAMRASAQMISYEIAMGFVLVIVLMVSGSLNLSEIVMLQTSGRFADMGLTFLSWNWLPLLPMFVIYIISGTAELNRHPFDVVEGESEIVAGHMVEYSGMSFAMFFLAEYANMILISMMATLMFLGGWSSPIDAMPFTWIPGWIWLGIKTLFVVTLFIWFRASFPRYRYDQIMRLGWKVFIPLTLVYLLIVAIWMKTPWNIWH

nuoH

NADH-quinone oxidoreductase subunit H

357 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.053 kDa

MDQLFASIHATGQSLLGYYWPLVWNLVKIIAVVAPLMGAVAYLTLWERKVIGWMHVRHGPNRTGPAGLLQPIADGVKLLLKEIVVPAKSSKALFVIAPIMTIMPALAAWAVIPFGPETVLADVNAGLLFVMAITSLEVYGVIVAGWASNSKYAFLGAMRASAQMISYEIAMGFVLVIILMVTGSMNLTTIVNTQNTGRFAEMGLTFLSWNWLPLLPMFFIYIISGTAELNRHPFDVVEGESEIVAGHMVEYSGMSFAMFFLAEYANMWLISIMATLMFLGGWTSPIDMAPFTWVPGWIWLGLKTLMVVTMFIWFRASFPRYRYDQIMRLGWKVFIPLTLVYLLIVAIWMKTPWNIWN

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.511 kDa

MAEFFAAPFWTDFLWPLIVMVAQSVLLLVVLLIAIAYILLADRKIWAAVQIRRGPNVVGPWGLLQSFADLLKFVLKEPIIPSGSNKGVFLLAPLVTCVLALAAWAVIPVNLNWVISDINVGILYIFAISSLSIYGIIMAGWSSNSKYPFLAALRSAAQMVSYEVSIGFVFITVLLCAGSLNLSAIVEAQHVRGLGSLIGLPWLTFLNWYWLPLLPMFVVFYVSALAETNRPPFDLVEAESELVAGFMVEYGSTPYLLFMLGEYVAITTMCAMGAILFMGGWLPPIDLPPFNWVPGVIWFSLKLFFMFFLFAMAKAIVPRYRYDQLMRLGWKVFLPLSLAMVVIVAGVLQFADIAPK

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.315 kDa

MADFFAMPLWTDFLWPLIVMVAQSVLLLVVLLIAIAYILLADRKIWAAVQIRRGPNVVGPWGLFQSFADLLKFVLKEPIIPSGANKGVFLLAPLVSCVLALAAWAVIPVNLNWVIADINVGILYIFAISSLSIYGIIMGGWASNSKYPFLAALRSAAQMVSYEVSIGFVIITVLLCAGSLNLSAIVEAQHTSGLATLIGLPWLTFLNWYWLPLLPMFVVFYVSALAETNRPPFDLVEAESELVAGFMVEYGSTPYLLFMLGEYVAITTMCAMGAILFMGGWLPPVDLPPFNWVPGVIWFSLKLFFMFFLIAMAKAIVPRYRYDQLMRLGWKVFLPLSLAMVVIVAAVLQFAGIAPK

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.99 kDa

MDWALILAWGIKILSLFFVILTGVAYYTLAERKFAGFIQDRPGPNRAGPFGIFQPLADGIKFIAKEEIFPKNVSKGMYLLAPTISMTCAIMAWAVIPFGGTLPAPEWLTTLTGVATIDLQIANPDSGVLYMLAISSLSVYGIMIAGWSSNNKYSLLGGVRSTAQMISYELPMGLSIVAIVIMTGSLKLTDISDSQKDMWNILSPPGFVAFFIYVTAMFAETNRLPFDLAEAESELVVGFHTEYGAFKFALFFLAEYMNMITMSCLTTLLFFGGYNVPFQLGAGSEYQAFIGLGFFILKVLFFAFLFIWVRWTLPRFRYDQLMKLGWKKMIPWGLFVVMFASIYTVYWKEGWMKLFI

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.48 kDa

MTDFIEQFGVWGGFGIAVLQILAFAVVLLISLAFLLLMDRKVWAAVQMRKGPNVVGAFGLLQSFADFFKFVFKEIVVPAGADRSLYLLAPLITLILAFVTWAVVPAAPGWVIADLNVGILYLFAMSSLGVYGIIIGGWASNSKYPFLGALRSAAQMVSYEVSIGFIIVTVLLFAGSMNLSEIIEMQGGGFWNWNVLSFHAWPMPMFLVMIPMAVIFFISALAETNRPPFDLPEAESELVAGYQVEYSSTPYLLFMVGEYLNIVLMCAMTAILFFGGWNDPFGLDVSGWPYLASHAWYFFWFAAKIVFFFFMFAMVKALVPRYRYDQLMRLGWKIFLPISLAAVALVGAAVVYGPQG

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.134 kDa

MADFFASSFWTGFLWPLIVMIAQSVLLLVVLLVAIAYILLADRKIWAAVQIRRGPNVVGPWGLFQSFADLLKFVLKEPIIPAGANKGVFLLAPLVSCVLALAAWAVIPTNLGWAIADINVGILFIFAISSLSIYGIIMAGWSSNSKYPFLAALRSAAQMVSYEVSIGFVIITVLLCAGTLNLSAVVEAQHARGLASLIGLPQLTILNWYVWPLFPMFVVFYVSALAETNRPPFDLVEAESELVAGFMVEYGSTPYLLFMLGEYVAITTMCALATILFLGGWLPPIDLPPFNWVPGVIWFALKLFFMFFLIAMAKAIVPRYRYDQLMRLGWKVFLPLSLVMVVIVAGVLHFAGIAPK

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.069 kDa

MADFFASSFWTGFLWPLIIMIAQSVLLLVVLLIAIAYILLADRKIWAAVQIRRGPNVVGPFGLFQSFADLLKFVLKEPIIPAGANKGVFLLAPLVSCVLALAAWAVIPTNLGWAIADINVGILFIFAISSLSIYGIIMAGWSSNSKYPFLAALRSAAQMVSYEVSIGFVIITVLLCAGTLNLSAVVEAQHARGLASLIGLPQLTILNWYVWPLFPMFVVFYVSALAETNRPPFDLVEAESELVAGFMVEYGSTPYLLFMLGEYVAITTMCALATILFLGGWLPPIDVAPFNWVPGVIWFALKLFFMFFLIAMAKAIVPRYRYDQLMRLGWKVFLPLSLVMVVVVAGVLHFAGIAPK

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.99 kDa

MDWALILAWGIKILSLFFVILTGVAYYTLAERKFAGFIQDRPGPNRAGPFGIFQPLADGIKFIAKEEIFPKNVSKGMYLLAPTISMTCAIMAWAVIPFGGTLPAPEWLTTLTGVATIDLQIANPDSGVLYMLAISSLSVYGIMIAGWSSNNKYSLLGGVRSTAQMISYELPMGLSIVAIVIMTGSLKLTDISDSQKDMWNILSPPGFVAFFIYVTAMFAETNRLPFDLAEAESELVVGFHTEYGAFKFALFFLAEYMNMITMSCLTTLLFFGGYNVPFQLGAGSEYQAFIGLGFFILKVLFFAFLFIWVRWTLPRFRYDQLMKLGWKKMIPWGLFVVMFASIYTVYWKEGWMKLFI

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.156 kDa

MQAFFANPAVSWTLLTTGGILLVVIWVLLSLAFLLLADRKIWAGVQMRKGPNVVGPFGLLQSFADFFKFVLKEIVIPAGADKVVFILAPLISLILAFVGWAVVPFAPGWVVSNLNVGILYLLAMSSLGVYGIIMGGWASNSKYPFLGALRSAAQMVSYEVSIGLIIITVILLAGSMNLSTIVEKQSGWIWNWNVFGGGLNNLVLLPVMVVAMGMFYISALAETNRPPFDLPEAESELVAGYQVEYSSTPYLLFMVAEYSNIVLMCAMISVLFFGGWNPGFPTDFLSSWHPFAANLFLALVFYAKICFWFFMFAMAKAIVPRYRYDQLMRLGWKVFLPTSLVLVAAVAAWRVFGPAA

nuoH

NADH-quinone oxidoreductase subunit H

356 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.539 kDa

MTICTDIIANGYDLKTLIYNSGVVSIKVIALIICLLLATAYLTFAERKVIAYMQLRVGPSLAGPFGLLQPIADAIKLVFKEPIIPAKADRKLFIIAPIITFVLSLLGWSVIPIDHDIVLSRIHIGGILFILAVTSLGVYGIIIAGWASNSKYAFLGAVRSAAQMISYELAMALSIVAVLIVTGEMDLIQIVEAQKTRPIWLTIMMLPLAVIYFISILAKTNRLPFDLPEAESELVAGYNVEYSSMAFAMFFLGEYANMILGSSLMTIMFLGGYLPPFNLEILTFIPGYIWFILKVSMVLFCFLWIRATLPRYRYDQLMYLGLKVFLPIVLAWIIVVSTILVYSNNLPIALETVLNK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.207 kDa

MFHLDFVTNWINKFLQKYLIDGWVLLVEFVLIAFVILIAYAVLALLLIYLERKVCAFFQCRLGPTRVGPWGIFQSVADMIKILLKELIRINKVDVCLFHLATYIVIIASICTFGAIPFDKGLHVVDFNIGVFYLLSVSSIGVVGILLAGWASNNKYTIIGAIRSGAQLISYELSCGLSLMTVVMLSGSLQLSSIVEQQSCGWNIVRGGIPAIIAFIIYLIAGHAETNRGPFDLPEAESELTAGYHTEYSGIQFGFFYLAEYLNMFIIAAIATTLFLGGWMPLHIPGWNLFNEVMDFIPSILWFFVKTFICIFLALWVRWTMPRLRIDQLLNLEWKILMPISLINIILMAFWIIYL

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.26 kDa

MSLFDTINAGGAELLGFAWPTVWAVVRILVVSVVILLCVAYLILWERKLIGWMHVRLGPNRVGPGGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPFQAEAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKVFALLSVFIWVRATFPRYRYDQIMRLGWKVFLPVTVVWVIVVGFWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.227 kDa

MSLFDTINAGGAQLLGFAWPTVWAVVRILVVSVVILLCVAYLILWERKLIGWMHVRLGPNRVGPGGLLQPIADVLKLLLKEVIQPTAASRWLYLIAPIMTVVPAFAVWAVIPFQAEAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKVFALLSVFIWVRATFPRFRYDQIMRLGWKVFLPVTVIWVVVVGCWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.209 kDa

MSLFDTINAGGAQLLGIAWPTVWAIVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPFQAEAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFVSGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGVFWLVLKVFALLSVFIWVRATFPRYRYDQIMRLGWKVFLPVTVIWVVVVGFWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.303 kDa

MSLFDTINAGGSQLLGFAWPTVWAIVRILVVSVVILLCVAYLILWERKLIGWMHVRLGPNRVGPGGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPFQAEAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALTATLFLGGWDAPFEFLSFIPGIFWLVLKIFALLSVFIWVRATFPRFRYDQIMRLGWKVFLPVTVVWVVVVGFWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.292 kDa

MSLFDTINAGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIQPTAASRWLYLIAPIMTVVPAFAVWAVIPFQAEAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVNSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKVFALLSVFIWVRATFPRFRYDQIMRLGWKVFLPVTVIWVVVVGFWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.194 kDa

MSLFDTINAGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIQPSAASRWLYLVAPVMTVVPAFAVWAVIPFQAQAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFVSGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKVFALLSVFIWVRATFPRYRYDQIMRLGWKVFLPVTVIWVVVVGFWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.194 kDa

MEFFESAFWTGFLWPLIIMVAESVLVLVVLLVAIAYILLADRKIWAAVQIRRGPNVVGPWGLLQSFADLLKFVLKEPIIPAGANKGVFLLAPLVSCVLALAAWAVIPTNLGWVISDINVGILFIFAISSLSIYGIIMAGWSSNSKYPFLAALRSAAQMVSYEVSIGFVIITVLLCAGTLNLSAVVEAQHVRGLASLIGLPQLTILNWYVWPLFPMFVVFYVSALAETNRPPFDLVEAESELVAGFMVEYGSTPYLLFMLGEYVAIVTMCAMATILFLGGWLPPVDLPPFNWVPGIIWFLLKVFFMFFLFAMAKAIVPRYRYDQLMRLGWKVFLPLSLAMVIVVAGVLHFAGIAPK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.209 kDa

MSLFDTINAGGAQLLGIAWPTVWAIVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPFQAEAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFVSGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGVFWLVLKVFALLSVFIWVRATFPRYRYDQIMRLGWKVFLPVTVIWVVVVGFWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.26 kDa

MSLFDTINAGGAELLGFAWPTVWAVVRILVVSVVILLCVAYLILWERKLIGWMHVRLGPNRVGPGGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPFQAEAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKVFALLSVFIWVRATFPRYRYDQIMRLGWKVFLPVTVVWVIVVGFWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

355 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.26 kDa

MSLFDTINAGGAELLGFAWPTVWAVVRILVVSVVILLCVAYLILWERKLIGWMHVRLGPNRVGPGGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPFQAEAVLANVNAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPAFVVYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKVFALLSVFIWVRATFPRYRYDQIMRLGWKVFLPVTVVWVIVVGFWMMSPLNIWVK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.582 kDa

MIESFNQFGSSLLGGFWPVVWNLIKIVALIAPLMGCVAYLTLWERKAIGWTQIRPGPNRVGPWGLLTPIADAVKLIFKEIILPTAANKGLFLLGPVMTIMPALAAWVVVPFGPEVALANINAGLLFLMAITSMEVYGVIIAGWASNSKYAFLGALRASAQMVSYEIAMGFALVVVLMVSGTLNMTEIVLGQDRGRFADMGLNFLSWNWLPLFPIFIVYFISGLAETNRHPFDVVEGESEIVAGHMIEYSGMAFAMFFLAEYANMILISALAVTMFLGGWLPPIDSVVFNWIPGWIWLGLKTFVVVTMFLWVRSTFPRFRYDQIMRLGWKIFIPITLIWLVVVGLWIQSPWNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.188 kDa

MSLFDTINSGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPFQAGAVLANINAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPVFVIYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKIFALLSVFIWARATFPRYRYDQIMRLGWKVFLPVCVFWVIVVGFWMMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.188 kDa

MSLFDTINSGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPFQAGAVLANINAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPVFVIYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKIFALLSVFIWARATFPRYRYDQIMRLGWKVFLPVCVFWVIVVGFWMMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.188 kDa

MSLFDTINSGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPFQAGAVLANINAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPVFVIYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKIFALLSVFIWARATFPRYRYDQIMRLGWKVFLPVCVFWVIVVGFWMMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.188 kDa

MSLFDTINSGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPFQAGAVLANINAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPVFVIYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKIFALLSVFIWARATFPRYRYDQIMRLGWKVFLPVCVFWVIVVGFWMMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.188 kDa

MSLFDTINSGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPFQAGAVLANINAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPVFVIYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKIFALLSVFIWARATFPRYRYDQIMRLGWKVFLPVCVFWVIVVGFWMMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.169 kDa

MSLFDTINSGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIHPTAASRWLYLIAPVMTVVPAFAVWAVIPFQAGAVLANINAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPVFVIYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDAPFEFLSFIPGIFWLVLKVFALLSVFIWARATFPRYRYDQIMRLGWKVFLPVCVFWVIVVGFWMMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.543 kDa

MIDWITSQGQGVLGAYWTPLWILIRAVIIVVPLLLCVAYLILWERKLIGWMHVRIGPNRVGPLGLLQPIADVLKLLLKEVMMPTQVSRGMYLIAPLMVLMPAVAIWAVIPFQAEVVMADVNAGLLYVMAISSVGVYGVILAGWASNSKYAFIGAMRAAAQMVSYEIAMGFALVTVLMVAGSLNLSAIVNGQNTGYFADMGINILSWNWLPLLPMFGVYFISGVAETNRHPFDVVEGESEIVAGHMIEYSGMGFALFFLAEYINMIIISTMTALMFLGGWAPPFESVVTNAIPGFFWLLIKVFLLLSVFIWIRASFPRYRYDQIMRLGWKVFIPLTVAWLIIVAIWIKSPWNIWH

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.442 kDa

MIESITSFGTATFGGWWPLVWTLVRAVCIILPLLLCVAYLILWERKLIGWMHVRLGPNRVGPMGLLQPIADVLKLLLKEVMVPSAVSRGMYIIAPLMVLMPAVAIWAVIPFQAEAMVSNINAGLLYVMAISSVGVYGVILAGWASNSKYAFLGAMRASAQMISYEIAMGFALVTVLMVTGSLNLSDIVNSQNRGFFAGHGINILSWNWLPLLPMFGVYFISGVAETNRHPFDVVEGESEIVAGHMIEYSGMAFALFFLAEYINMIVISALTATLFLGGWASPIDAPVLNWIPGFFWLLIKVFLLLSVFIWLRASFPRYRYDQIMRLGWKIFIPLTVGWLVVVAIWLVSPWNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.511 kDa

MIESITSFGAATFGGWWPLIWTLVRAVCIILPLLLCVAYLILWERKLIGWMHVRVGPNRVGPMGLLQPIADVLKLLLKEVMVPSAVSRGMYIIAPLMVLMPAVAIWAVVPFQAEAVVSNINAGLLYVMAISSVGVYGVILAGWASNSKYAFLGAMRASAQMISYEIAMGFALVTVLMVTGSLNLSDIVNSQNRGFFANHGINILSWNWLSLLPMFGVYFISGVAETNRHPFDVVEGESEIVAGHMIEYSGMAFALFFLAEYINMIVISAMTATMFLGGWSAPIDAPVFNWIPGFFWLLIKVFLLLSVFIWLRASFPRYRYDQIMRLGWKIFIPLTVGWLIIVAIWLVSPWNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.367 kDa

MFDALQAWLSSFLFDWLAVLITLVLQAVAVILPVMITVAWLTYAERKVIGYMQVRMGPNRVGPGGWLQPIADAIKAMTKEVVIPAQSNKYLFIIAPILALAPAVAAWAVIPFDANGVVAADINAGVLYVLAVASIGVYGIVISGWASNSKYAFLGALRASAQKISYEIAMGFALVTVLMVADTMNLTGIVEGQQGGIWNWYWIPLLPMFFVYFISGLAETNRAPFDVAEGESEIVAGFHVEYSGMAFAVFFLAEYAMMILISFMTAIMFLGGWYSPFEGIAGLESVFSWVPGFVWLFAKVAFLLFLFLWFRATFPRYRYDQIMRLGWKVLIPVTIVWVFVVGVMEYFKVSPWFN

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.832 kDa

MIDWITSQGHDIFGMYWTPLWILIRAVLIVVPVLLCVAYLILWERKLIGWMHVRIGPNRVGPLGLLQPIADVLKLLLKEVMFPSQINRGMYLVAPLMVLMPAVAVWAVIPFQAEVVMADINAGLLYVMAISSVGVYGVILAGWASNSKYAFIGAMRAAAQMVSYEIAMGFALVTVLMVSGSLNLSHIVNAQNTGYFANMGLNLLSWNWLPLLPMFGVYFISGVAETNRHPFDVVEGESEIVAGHMIEYSGMTFALFFLAEYINMIIISTMTSLMFLGGWAPPFSSALTNAIPGFFWLVIKVFLLLSVFIWIRASFPRYRYDQIMRLGWKIFIPLTVAWLIIVAIWIKSPWNIWH

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.477 kDa

MIDWITSQGQGLLGAYWTPLWILIRAVIIVVPLLLCVAYLILWERKLIGWMHVRIGPNRVGPLGLLQPIADVLKLLLKEVMMPTQVSRGMYLIAPLMVLMPAVAVWAVIPFQAEVVLADVNAGLLYVMAISSVGVYGVILAGWASNSKYAFIGAMRAAAQMVSYEIAMGFALVTVLMVAGSLNLSAIVNGQNTGYFADMGINILSWNWLPLLPMFGVYFISGVAETNRHPFDVVEGESEIVAGHMIEYSGMGFALFFLAEYINMIIISTMTALMFLGGWAPPIDSVLTNAIPGFFWLVIKVFLLLSVFIWIRASFPRYRYDQIMRLGWKVFIPLTVAWLIIVAIWIKSPWNIWH

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.445 kDa

MIDWITSQGHAIFGGAWTPLWILIRAVLIVVPLLLCVAYLILWERKLIGWMHVRLGPNRVGPLGLLQPIADVLKLLLKEVMTPTHVSKGMYLIAPLMVLMPAVAIWAVIPFQAEVVMADVNAGLLYVMAISSVGVYGVILAGWASNSKYAFLGGMRAAAQMVSYEIAMGFALVTVLMVSGSLNLSAIVNSQNTGYFANMGINVLSWNWIPLLPMFGVYFISGVAETNRHPFDVVEGESEIVAGHMIEYSGMAFALFFLAEYINMIIISTITALLFLGGWAPPFSSFVTNAIPGFFWLLIKVFLLLSVFIWIRASFPRYRYDQIMRLGWKVFIPLTVGWLIIVAIWIKSPWNIWH

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.069 kDa

MTLFESINAGGTQILGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIQPTQASRWVYLVAPVMVVVPAFAVWAVIPFQAGAVLGDINAGLLYAISISSVGVYGVILAGWASNSKYAFLGAMRAAAQMVSYEVSMGFALVVVMMTAGTMNLSDIVGSQMRGIFASHGVTFLSWNWLPLLPAFVVYFVSGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALASILFLGGWSAPFEFLSFIPGIVWLVLKVFLLLSVFIWVRATFPRYRYDQIMRLGWKVFLPVTVIWVVVVGFWIMSPLNIWN

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.985 kDa

MSLFDTINSGGTQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIQPAQASRWIYLIAPIMVVVPAFAVWAVIPFQAGAVLGDINAGLLYAMAISSIGVYGVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVVVLMTAGTLNLSGIVASQEHGIFASYGLNFLSWNWLPLLPMFVVYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWSAPFGFLSFVPGIVWLVAKVFLLLSVFIWARATFPRYRYDQIMRLGWKIFIPVCVVWLVVVGFWIMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.017 kDa

MSLFDTINSGGTQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIQPAQASRWIYMVAPIMVVVPAFAVWAVIPFQAGAVLGDINAGLLYAMAVSSIGVYGVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVVVLMTAGTLNLSGIVGSQEHGFFASHGLNFLSWNWLPLLPMFVVYFISGIAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWSAPFGFLSFIPGIVWLVAKVFFLLSVFIWARATFPRYRYDQIMRLGWKIFIPVCVVWLVVVGFWIMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

353 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.155 kDa

MSDFWVHLLVYLVILFGFVIVSVLLFIWLERRFIGRFQLRPGPNRAGPFGLLQPIADAIKVLIKEDIIPTESDKGVFWLAPLVAFVPVMLMFAAIPFADGAMLVDLNIGILYILAVSSVTVIGIFMAGWSSNSKYSLLGAMRTIAQEVSYEIPLVLSILGVVMLTGSLSMNEIVKAQSVPFVLLQPLGFFVYLSAAMAEINRTPFDLLEAESEIIAGFHTEYSGMKFGLFYLMEYAEVLAISAIATTLFLGGWQGPLLHPVIWFITKVLIIFMFIIWVRATIPRLRIDQVMAFGWKFLLPLSLANLVITAFEILAAPDMNTAVLIGINIAVMFGLILLFSRFYKLGGGRVSVK

nuoH

NADH-quinone oxidoreductase subunit H

353 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.202 kDa

MSDFWIHLLVYLVILFGFVIVSVLIFIWLERRLIGRFQLRPGPNRAGPFGLLQPIADAIKVLIKEDIIPSEADKGVFWLAPLVAFVPVMLMFAAIPFADGVMLVDLNIGILYILAVSSVTVIGIFMAGWSSNNKYSLLGAMRTIAQEVSYEIPLVLSILGVVMLTGSLSMNEIVKAQDVPFILLQPLGFFVYLSAAMAEVNRTPFDLLEAESEIIAGFHTEYSGMKFGLFYLMEYAEVLAVSAIATTLFLGGWQGPLLHPVFWFIAKILLVFMFIIWVRATLPRLRIDQVMAFGWKFLLPLSLANLVITAFEILIAPDINTAVLIGINIAVMFGLVLLFSRFYKLGGGRVSIK

nuoH

NADH-quinone oxidoreductase subunit H

352 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.326 kDa

MDILQRLMAQLLSSGSSVFVMLSAIVGVMISVAYLVYMERKVIAFMQLRHGPSVVGPFGLLQPFADALKLVTKESIVPLQSRNFAFFIAPVITFTLALSGWAVIPLGASTYVINGVETTIPASIANINLGVLYIFAISSLEVYGIIMAGWSSGSKYAFLGAIRSASQMISYEVSMGLVVLSVAVSAGSLRLVDIVVMRHTMPYWVDLLLLPMAFVFFISILAETNRHPFDLPEAESELVSGYNVEYSSMPFAMFFLGEYANMILVSAMMTIFFLGGWYPPIDVQFLYLIPGFVWFCLKVLLLLFCFIWVRATIPRYRYDQLMRLGWKVFLPFSFVWVMVVSGVLLYLDKLPK

nuoH

NADH-quinone oxidoreductase subunit H

351 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.924 kDa

MEAIRALNELPKNIAAAIRGLFADPYSLWADLTMTLIGMILIIVVIVISALLLIVLERKIAGWGSQRPGPNRLGPRGWFQTIADALKLLGKEDLTPANADRIMFKIAPMFIFGIPILTLTIIPFGYAMTVIDLELGVFFYLGITSVSTLALLMAGWSSNNKYSLLGGMRAVAQMISYEIPLIFSLLGVVMLTQTFNLTKIVEAQAALPFIFLQPIAFIIFLICGQAEVNRAPFDLLEADQEIIAGPFTEYTGLRWGLFYLGEYANLVAMCALATTVFLGGWQGPGVLPGWAWFWLKVGLLIFISMWVRWTFPRIRIDHLMHLAWKVLLPLALLNILLTGLGIYIYQLVIGG

nuoH

NADH-quinone oxidoreductase subunit H

350 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.173 kDa

MESAFIIEKSVVIVVVFAVTMIMAMYSTWAERKVAAFLQDRVGPNRAGWGGLLQPLADGMKLFSKEEFFPNTPNRFLFVVGPAIAMSTALMTSAVIPWGDRLHLFGKDIILQATDVNIALLYIFGVLSVGVYGIMIGGWASNNKFSLMGAVRAASQMVSYEIAMGLSMIALLMMTGTMSLKVISEQQAGMNWNVFYQPLSFLIFLICSFAETNRTPFDLAECENELIGGYHTEYSSMKMGFYLFAEYASMFISSTIISVLFFGGYNYPGMQWMVDNVGVNTANLLGIAVLFVKICFFIFFYMWVRWTIPRFRYDQLMNLGWRILIPLSIINIMITGAVILRHDIAAALGF

nuoH

NADH-quinone oxidoreductase subunit H

350 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.252 kDa

MGENLFVGMAKGLRTWLESQHFVPLVTDVFLMLLAVVGVLAFLFLNALFLIYYDRKFGAWVQARLGPNRVGPRGIFQTVADTVKLFAKEIFIPNNVDRWPYLLAPVLIFTIPVMLFLVIPFGKGMVPYDLNLGVLYLVAITSVETIVLWMAGWSSNNKYSLLGAMRSVAQMLSYEMPVILAMLSVVMMAGSMKLSDIVAAQQKVWFIFLQPVGFLIYFIAVNAEFKRTPFDLVEGESEIISGPYTEYSGMNFALFFLAEYTNFMIGAIMVTTLFLGGWNAPFGWTFIPSWLWFIIKMYFVITLYMWTRWTFLRIRIDQMLNFAWKFLLPVSLANIFITGFGLYLYRMIRW

nuoH

NADH-quinone oxidoreductase subunit H

349 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.454 kDa

MEALLEPVVQLFGPAWPAVWTLTKIVAIIAPLMLCVAYLTLAERKVIGYMQVRIGPNRVGPKGLLQPIADGMKLLFKEIIVPTGASKGLFILGPILAIAPSLAAWAVVPFGEGMVLADVNAGLLFLLAITSVEVYGVIIAGWASNSKYPFLGSMRAAAQMVSYEVAMGFALICVLLISASLNLTDIVRSQGQGQFHEMGLSFLSWNWIPLFPMFIVFLISGIAETNRAPFDVVEGESEVVAGHMVEYSGMAFALFFLAEYANMILVSILTSVLFVGGWLSPVSFLPDGFFWLALKTAFFLFVFLWARATFPRFRYDHIMRLGWKVFIPITLVWVIVVAVWMMSPLSIWK

nuoH

NADH-quinone oxidoreductase subunit H

349 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.239 kDa

MEGFLQPVADLFGPSWPVVWTLLKIVAIVAPLMGCVAYLTLAERKVIGYMQVRIGPNRVGPFGLLQPIADGVKLLLKEIIFPSSASKGLFIVGPILALAPSLVAWAVVPFDDGLVLANVNAGLLFLLAVTSMEVYGVIVAGWASNSKYPFIGAMRAAAQMVSYEVSMGFALICVLLISSSLNLSEIVNSQGSGRFHDMGLSFLSWNWLPLLPMFVVYLISGIAETNRAPFDVVEGEAEIVAGHMVEYSGMAFALFFLAEYANMILVSILTSVLFLGGWLSPVGFLPDGFHWLALKTASILFIFLWARATFPRFRYDHIMRLGWKVFIPVTLVWVVVVAVWLMSPLSIWK

nuoH

NADH-quinone oxidoreductase subunit H

349 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.086 kDa

MIYDFFMTWLFPLLIIVGKTLLLLVILLLLVAYLLYADRKIWAAVQLRRGPNVVGPWGLLQSFADLIKFVVKEPIIPAGANKGVFLLAPFVSATLALSTWAVIPVNEGWAVANINVGLLYILAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVLVTVILVSGSLDLTTIVQKQSHGMGTALGLPFNSFLDWNWLVLFPMFIIFFISALAETNRPPFDLVEAESELVAGHMVEYSSTPYMLFFLGEYVAIVLMCALTTILFLGGWLPPLDVWWLNWVPGIIWFVLKVCFVFFWFAMVKAFVPRYRYDQLMRLGWKVFLPLSLAMVVITAAFLKYTGFA

nuoH

NADH-quinone oxidoreductase subunit H

349 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.702 kDa

MDALMNFGTGIFGGAWPAVWTLIKIVLIVAPMMLGVAYLTYFERKVIGYMQVRIGPNRVGPWGLIQPIADGLKLLMKEIIVPSGANKGIFIIAPMLAIAPALAAWAVVPFTDSLVLANIDASLLYIMAITSMGVYGIILSGWASNSKYAFLGAMRSAAQMVSYEISMGFSLICVLMVSNSLNLVEIVNVQNQGRFAGWGLSFLSWNWLPLFPMFLVYLISGVAETNRAPFDVAEGESEIVAGFHVEYSGMAFAVFFLAEYANMILVSALTSIMFLGGWLSPVSFLPDGILWLFAKMSAILFLFLWFRATFPRYRYDQLMRLGWKVFVPICLIWLVVVGVWMMSPLNIWK

nuoH

NADH-quinone oxidoreductase subunit H

349 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.076 kDa

MEFLQGILGTDAGLLVWTLLKIIAIVLPMLGCVAYLTLAERKVIGYMQIRIGPNRVGPFGLLQPIADAVKLLMKEIILPTNSSKGLFLLAPVLSIGPALAAWAVIPFTDKLVLANVNASLLYILALTSMGVYGVIIAGWAGNSKYSFLGAMRSAAQIVSYELAMGFALVGVLMVSGSLNLVDIVHQQSFGKGGGSILSWNWIPLFPLFIVYLISGVAETNRAPFDVAEGESEIVAGFHVEYSGMAFAIFFLAEYANMILVAALTSLLFLGGWLSPFPASWGILGAGGFFWLAVKMALVLFCFLWFRATFPRYRYDQIMRLGWKVFIPVTLVWILVVGAWMFSPLSIWKL

nuoH

NADH-quinone oxidoreductase subunit H

348 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.762 kDa

MTALFQSWGLPYDWAWFVSTIIGILVIALPLMLAVAMIIYADRKIWAAMALRRGPNVVGPWGLLQSFADGAKVFLQETIIPAAANKGLFLLAPIITFTVALIVWAVIPFAPGVVLADINIGLLYVLAASSIGVYGVIIAGWASNSKYPFYSALRAAAQMVSYEVSIGFVLISVVLWTGSFNMSAIVEGQRAHIFGFINGYGFNPLLFPMAVVFLISAMAETARTPFDLTEAESELVAGYQTEYSSMSFALYWLGEYANVILMCGLNAILFWGGWLPPVDWAPLYMVPGIIWFFAKLLFFFFVFSWVKATVPRYRYDQLMRLGWKVFLPLSLFWVFLVSGWLMLTRYGV

nuoH

NADH-quinone oxidoreductase subunit H

348 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.028 kDa

MTEFFQTLGMNYEWAWFTATIAGILLIALPVMLAVAMVIYVDRKVLGAIMLRRGPNVVGPFGLLQSFADGLKVFLQETIIPSAANKGIFLLAPIVTFVVALVAWAVIPFGDGMVLADINVGLLYVLAISSLGVYGIVMAGWASNSKYPFFSAMRAAAQMISYEVSIGFILICVVLWAGTFNLSEIVEAQRGHGLGIVNGYFFNILLFPMWVLFFISCLAETQRAPFDLTEAESELVAGYQTEYSSMSFALFWLGEYANILLLCSLNTVLFFGGWLPPIDWAPLYYVPGFLWFLIKTFLFFFMFSWIWATVPRYRYDQLMRLGWKVFLPMSLLFVFLISGYLMATGHYG

nuoH

NADH-quinone oxidoreductase subunit H

348 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.448 kDa

MEQFFWSYVWPALIMVGQSLLLLVCLLVAIAFLLLADRKVWAAVQLRRGPNVVGPFGLFQSFADLLKFILKEPVIPAGANKAVFLLAPLVAVTLALATYAVIPFADGWVVANINVGILYIFAISSLEVYGIIMGGWASNSKYPFLGALRSAAQMVSYEVSIGLVIVTVLLCVGSLNLTDIVLAQRTGLGTMMGLPASFLDWHWLSLFPMFIVFFISGLAETNRPPFDLPEAESELVAGHMVEYGSTPYMMFMLGEYAAIVLICCLTTILFLGGWLPIVDVWFLNWVPGIVWFALKGCMVFFMIALTKAFVPRYRYDQLMRLGWKVFLPLSLAMVVIVAFVLKLTGWAG

nuoH

NADH-quinone oxidoreductase subunit H

348 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.943 kDa

MDNFFMTWLLPLFIVVGKTLLLLTVLLVLIAYLLYADRKIWAAVQLRRGPNVVGPWGLLQSFADLIKFVVKEPIIPSGANKGVFLLAPFVSATLALSAWAVVPVNEGWEIASINVGLLYILAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVLVTVILVSGSLDLTTIVQEQNKGLGTYLGLPFSSLLDWNWLILFPMFIIFFISALAETNRPPFDLVEAESELVAGHMVEYSSTPYMLFFLGEYVAIVLMCALTTILFLGGWLPPLDVWWLNWVPGVIWFVLKVCFVFFWFAMVKAFVPRYRYDQLMRLGWKVFLPISLAMVVITAAILKYTSFA

nuoH

NADH-quinone oxidoreductase subunit H

348 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.092 kDa

MDDFFMIWLLPLLIIVGKTLLLLVVLLVLVAYLLYADRKIWAAVQLRRGPNVVGPWGLLQSFADLIKFVVKEPIIPAGANKGVFLLAPFVSATLALSTWAVIPVNEGWEVAKINVGLLYILAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVLVTVILVSGSLDLTTIVHKQSYGIGTTLGFPFNSFLDWNWLVLFPMFIIFFISALAETNRPPFDLVEAESELVAGHMVEYSSTPYMLFFLGEYVAIVLMCALTTILFLGGWLPPLDVWWLNWVPGIIWFVLKVCFVFFWFAMVKAFVPRYRYDQLMRLGWKVFLPFSLAMVVITATFLKYTGFA

nuoH

NADH-quinone oxidoreductase subunit H

348 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.013 kDa

MYDFFMTWLLPFLIIVGKTLLLLVVLLVLVAYLLYADRKIWAAVQLRRGPNVVGPWGLLQSFADLIKFVVKEPIIPAGANKGVFLLAPFVSATLALSTWAVIPVSEGWEVAKINVGLLYILAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVLVTVILISGSLDLTTIVLKQGQGLGTTLGLPFNSFLDWNWLVLFPMFIIFFISALAETNRPPFDLVEAESELVAGHMVEYSSTPYMLFFLGEYVAIVLMCALTTILFLGGWLPPLDVWWLNWIPGVIWFVLKVCFVFFWFAIVKAFVPRYRYDQLMRLGWKVFLPLSLAMVVITAAFLKFTNFV

nuoH

NADH-quinone oxidoreductase subunit H

348 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.822 kDa

MTVEDIFTGIAAYLRGFLAGAPPWVVTLAIGVLYLIGVLAFIFLNALYLIYLERKISAYMQQRIGPNRLGPHGLLQSVADAVKLLGKEDIIPRGADRWVFIIAPVLIFIPATMLYAVIPFGKGMVPADLNIGVFYFLAVASTTTIAILMGGWGANNKYALLGSMRCVAQMVSYEIPLTFSILGVIMLAGSLQTSQIVAAQGKIWYILLQPLAFIIYFIAATAEVNRAPFDLVEGEQEIIAGPYTEYTGMRYALFYLSEYANLVSVSALAVTLFLGGWQGPWLPSWLWFLIKVYIMIFIFMWVRWTFPRIRIDHLLSFNWKVLLPLSLANILVTGVGIKIYQLLTLGRW

nuoH

NADH-quinone oxidoreductase subunit H

348 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.971 kDa

MESIRIIPEVPSFLNQVLSVDAWNILFLVGQALVIFLVVVIVAALMIIYERRMLALWQDRYGPNRVGPWGSLQLVADMLKIFFKEDWTPKFADKFMFILAPAVAMFTALASFAIIPVSPMLGVADWNIGILFFFAMAGMAVYAVMFGGWASQNKYSLLGGLRSAAQTISYEVFLGLSLMGVVAMTGSFNLRDIVVAQQGGFWHWNIFPQFLGFLTFVVAGVAVTHRHPFDQPEAEQELAEGYHVEYSGMKFGMFFIGEYVNVVLISALMTCLFFGGWDAPLNLGFTILPPAFWFMIKTLFFMTMFVLARGSLMRPRYDQVMNFGWKVCLPVTLINLMITAALILISAA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.456 kDa

MTDFFQSLGMSYEWAWGLATVAGILLIALPLMLAVAMIIYADRKIWAAIALRRGPNVVGPFGLLQSFADGLKVFLQETIIPSGANRGLFLIAPIITFTVALLAWAVIPFNSGAVLADINVGLLYILAISSLGVYGVILSGWASNSKYPFFSALRASAQMISYEVSIGFILIGVVLFADSFNMNEIVKAQQGHGLGIVNAFGFNLLLFPLAVMFLISSLAETARAPFDLTEAESELVAGYQTEYSSMSFALFWLGEYANVLLMCTLNAVLFWGGWLPPIDWAPLYAVPGIIWLFAKILFFFFVFSWVKATVPRYRYDQLMRLGWKIFLPISLIWIFLISGYLMLTRYS

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.383 kDa

MDSFVSTYLWPALIMIGQSLLLLVCLLVFIAYILLADRKIWAAVQLRRGPNVVGPFGLFQSFADLLKFMVKEPIIPAGANKAVFLLAPLVSVVLALSTWAVVPVANGWVIANINVGILYILAISSLEVYGIIMGGWASNSKYPFLGALRSAAQMVSYEVSIGLVIVTVLLCVGSLNLTDIVMSQQTGLGTKLGLPASFLDWHWLSLFPMFIVFFISALAETNRPPFDLPEAESELVAGFMVEYGSAPYMMFMLGEYAAVVLMCSLTTILFLGGWLPPVDIWILSWVPGIIWFMLKACFVFFMFAMVKAFVPRYRYDQLMRLGWKVFLPLSLAMVVIVAFVLKLTGWA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.251 kDa

MDSFVSTYVWPAAIMIGQSLLLLVCLLVFIAYILLADRKIWAAVQLRRGPNVVGPWGLFQSFADLLKFVFKEPIIPAGANKAVFLLAPLVAVTLALATWAVIPLNQGWVIANINVGILYVFAISSLEVYGIIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLCAGSLNLTDIVNSQNHGLGTMMGMPASLLDWHWLSLFPMFVIFFISALAETNRPPFDLPEAESELVAGFMVEYGSTPYMMFMLGEYAAIVLMCALTTILFLGGWLPPLDIAVLNWVPGIIWFILKATLVFFMFGITKAIVPRYRYDQLMRLGWKVFLPLSLAMVVIVAFVLKLGGWA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.455 kDa

MTEFFMGLGLSYEWAWGISTIAGILLIALPLMLGVAMIIYADRKIWAAMALRRGPNVVGPLGLLQSFADGLKVFLQETIIPTAANKGLFLIAPIITFTVALMAWAVIPFNSGAVLANINVGLLYVLAISSLGVYGVVIAGWSSNSKYPFFSAMRASAQMISYEVSIGFILICVVLWAGTFNLNDIVKAQQSHVWIINGFVANPLLFPMWVMFLISGMAETARAPFDLTEAESELVAGYQTEYSSMAFALYWLGEYANVLLMCALNAVLFWGGYLPPLDIPVLYLVPGFVWLLLKILFFFFIFSWVKATVPRYRYDQLMRLGWKVFLPVSLLFVFLVSGYLMATGHFA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.439 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFVSAVLAMATWAVIPVNEGWAIANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLALFPMFVIFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTTLFLGGWLPPVDVWFLNWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.84 kDa

MQVTRIIPDVPSFLASMMTFDTWSILFMVVQSLVIFLVVVIVAAMMIIYERRMLALWQDRYGPNRVGPFGSLQLVADMLKIFFKEDWTPNFTDKFMFTLAPAVAMFTALASFAIIPISPTLGVADWDIGILFFFAMAGIAVYAVLFGGWASANKFSLLGGLRSAAQTISYEVFLGLSLMGVVALTGSFNLRAIVEAQADGWYIIPQFFGFLTFVVAGVAVTHRHPFDQPEAEQELAEGYHVEYSGMKFGMFFIGEYVNVVLISALMTCLFFGGWLAPFNLDIPFIPPAFWFMIKTLFFMTMFILARGSLMRPRYDQVMNFGWKVCLPVTLINLLVTAAVILIFSPTL

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.826 kDa

MQVTRIIPDVPSFLASMMTFDTWSILFMVVQSLVIFLVVVIVAAMMIIYERRMLALWQDRYGPNRVGPFGSLQLVADMLKIFFKEDWTPNFTDKFMFTLAPAVAMFTALASFAIIPISPTLGVADWDIGILFFFAMAGIAVYAVLFGGWASANKFSLLGGLRSAAQTISYEVFLGLSLMGVVALTGSFNLRAIVEAQADGWYIIPQFFGFLTFVVAGVAVTHRHPFDQPEAEQELAEGYHVEYSGMKFGMFFIGEYVNVVLISALMTCLFFGGWLAPFNLDIPFIPPAFWFMIKTLFFMTMFVLARGSLMRPRYDQVMNFGWKVCLPVTLINLLVTAAVILIFSPTL

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.554 kDa

MDSFFSTYVWPAIIMIGQSLLLLVCLLVFIAYVLLADRKIWAAVQLRRGPNVVGPFGLFQSFADLLKFVFKEPIIPAGANKAVFLLAPLVTVLLALSTWAVVPLADGWVIANINVGILYIFAISSLEVYGIIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLCVGSLNLTDIVNAQHTGLGTMLGLPASFLDWHWLSLFPMFIIFFISALAETNRPPFDLPEAESELVAGFMVEYGSSPYMMFMLGEYAAVCLMCALTTILFLGGWLPPVDIWILNWVPGIIWFTLKACFVFFMFAMVKAFVPRYRYDQLMRLGWKVFLPLSLAMVVIVAFVLKLMGWA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.371 kDa

MDTFFSFYVLPALLILLKSVVLIVVLLIFVAYILYADRKIWAAVQLRRGPNVVGPWGTLQAFADLLKFVFKEPVIPSGANKGVFLLAPLVSAVLAISAWAVIPVNQGWAIANVNVGILYVFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTAGSLNLSDIVLSQHDGIGTRLGLPNTFLDWNWLALFPMFIIFFISALAETNRPPFDLVEAESELVAGHMVEYSSTPFLLFFLGEYVAIVLMCALATILFLGGWLPPFDFVPFTWVPGVIWFVLKVCFVFFGISMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATAAFLKITGFA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.541 kDa

MDSFFSTYVLPAIIMIGQSLLLLVCLLVFIAYVLLADRKIWAAVQLRRGPNVVGPFGLFQSFADLLKFVFKEPIIPAGANKAVFLLAPLVTVLLALSTWAVVPLADGWVIANINVGILYIFAISSLEVYGIIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLCVGSLNLTDIVNAQHTGLGTMLGLPASFLDWHWLSLFPMFIIFFISALAETNRPPFDLPEAESELVAGFMVEYGSSPYMMFMLGEYAAVCLMCSLTTILFLGGWLPPVDIWILNWVPGIIWFMLKACFVFFMFAMVKAFVPRYRYDQLMRLGWKVFLPLSLAMVIIVAFVLKLMGWA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.428 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNEGWAVANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLCLFPMFVVFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTVLFLGGWLPPVDVWFLSWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.428 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNEGWAVANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLCLFPMFVVFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTVLFLGGWLPPVDVWFLSWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.428 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNEGWAVANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLCLFPMFVVFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTVLFLGGWLPPVDVWFLSWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.428 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNEGWAVANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLCLFPMFVVFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTVLFLGGWLPPVDVWFLSWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.573 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQRFADLLKFVFKEPIIPSGANKGVFLLAPFIFAVLAMATWAVIPVNEGWAVANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLCLFPMFVVFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTVLFLGGWLPPVDVWFLSWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.458 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNESWAVANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLCLFPMFVVFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTVLFLGGWLPPVDVWFLSWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.428 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNEGWAVANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLCLFPMFVVFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTVLFLGGWLPPVDVWFLSWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.428 kDa

MEGIFAAYVLPALIIALKSVVLLVVLLIVVAYLLYADRKIWAAVQLRRGPNVVGPWGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNEGWAVANINVGILYIFAISSLEVYGVIMGGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLTVGSLNLTDIVLSQNTGLGTMLGLPASFLDWNWLCLFPMFVVFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAITLMCALMTVLFLGGWLPPVDVWFLSWVPGIIWFMLKLCFCFFLFAMVKAFVPRYRYDQLMRLGWKVFLPISLFMVVATATFLKVFGLA

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.204 kDa

MESFVTLYVLPGLLILLKSVALIVILLVGVAYILYADRKIWAAVQLRRGPNVVGPWGLFQAFADLFKFVFKEPVIPSGANKGVFLLAPVVAAGLALAAWAVIPVSEGWAIANINVGILYVFAIASLEVYGVIMAGWASNSKYPFLGALRSAAQMVSYEVSIGFVIVTVLLAVGSLNLTDIVLSQRDGLGTMVGLPNSFLDWHWLALFPMFIIFFISALAETNRPPFDLVEAESELVAGHMIEYSSTPFLLFFLGEYVAIVLMCALTTILFLGGWLPPFDFAPFTWVPGVVWFVLKLVAVFFMFALVKSFVPRYRYDQLMRLGWKVFLPISLFMVVATAAFLKFTGLV

nuoH

NADH-quinone oxidoreductase subunit H

347 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.513 kDa

MTICTDIIANGYDLKTLIYNSGVVSIKVIALIICLLLATAYLTFAERKVIAYMQLRVGPSLAGPFGLLQPIADAVKLVFKEPIIPAKADRKLFIIAPIITFVLSLLGWSVIPIDHDIVLSRIHIGGILFILAVTSLGVYGIIIAGWASNSKYAFLGAVRSAAQMISYELAMALSIVAVLIVTGEMDLIQIVEAQKTRPIWLTIMMLPLAVIYFISILAKTNRLPFDLPEAESELVAGYNVEYSSMAFAMFFLGEYANMILGSSLMTIMFLGGYLPPFNLEILTFIPGYIWFILKVSMVLFCFLWIRATLPRYRYDQLMYLGLKVFLPIVLAWIIVVSAILVYSNNLP

nuoH

NADH-quinone oxidoreductase subunit H

346 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.039 kDa

MNWNEILFWLLKSGLFFFILITACAYYTLAERKVAGFIQDRKGPNRAGIWGLLQPLADGIKFLTKEEVFPTQVNKIMYLIAPAISMTCAIMAWSVVPLGGRIPLPQWLQDRTGLVFLDLQIANPDTGILFLFAISSLAVYGIIIAGWASNNKYSLLGAIRSTAQMISYELPLSMSVVSIVILTGSLKLTDISASQAGLWNIFKLPGFIAFCLFVVAMFAETNRLPFDLAEAESELVVGFHTEYGAFKFALFFIAEYMNMITMSCVVTLLFFGGYQVPFGILEGHVLQSLFGLFFFLGKVLFFTFLFVWVRWTLPRFRYDQLMSLGWKKLIPWAVLNILIASLYIQF

nuoH

NADH-quinone oxidoreductase subunit H

346 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.964 kDa

MNWNEILFWLLKSGLFFFILITACAYYTLAERKVAGFIQDRKGPNRAGFWGLLQPLADGIKFLTKEEVFPVQVNKVMYLIAPAISMTCAIMAWSVVPLGGQIPLPSWLQEKTGLTFLDLQIANPDTGILFLFAISSLAVYGIIIAGWASNNKYSLLGAVRSTAQMISYELPLGMSVVSIVILSGSLRLTDISASQVGLWNIFKLPGFIAFCLFVVAMFAETNRLPFDLAEAESELVVGFHTEYGAFKFALFFIAEYMNMITMSCVVTLLFFGGYQVPFGILEGHVLQPLFGLVFFLGKVLFFTFLFLWVRWTLPRFRYDQLMSLGWKKLIPWAILNILIASIYIQF

nuoH

NADH-quinone oxidoreductase subunit H

346 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.964 kDa

MNWNEILFWLLKSGLFFFILITACAYYTLAERKVAGFIQDRKGPNRAGFWGLLQPLADGIKFLTKEEVFPVQVNKVMYLIAPAISMTCAIMAWSVVPLGGQIPLPSWLQEKTGLTFLDLQIANPDTGILFLFAISSLAVYGIIIAGWASNNKYSLLGAVRSTAQMISYELPLGMSVVSIVILSGSLRLTDISASQVGLWNIFKLPGFIAFCLFVVAMFAETNRLPFDLAEAESELVVGFHTEYGAFKFALFFIAEYMNMITMSCVVTLLFFGGYQVPFGILEGHVLQPLFGLVFFLGKVLFFTFLFLWVRWTLPRFRYDQLMSLGWKKLIPWAILNILIASIYIQF

nuoH

NADH-quinone oxidoreductase subunit H

346 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.434 kDa

MVEFFTQTTTGAILLILLQCLLLVVPLLVALAFLMYADRKIWAAVMMRKGPNVVGAFGLLQSFADFLKYIVKEIVVPAGADRAVYFLAPIVSLVMALIAWAVIPFNDGWVLSSLNVAVLYVFAVSSLEVYGVIMGGWASNSKYPFLGSLRSAAQMISYEVSIGLIIIGVIISTGSMNFTAIVHAQDGDLGLLNWYFLPHFPMLFLFFISALAETNRPPFDLPEAEAELVAGYQVEYSSTPFLLFMIGELVAVVLMCALTVLLFFGGWLSPIPGLPDGVFWMILKMLAVFFMFSMVKAIVPRYRYDQLMRLGWKVFLPFSLFWVVFVAFMARYEVLGGFWARFAVGG

nuoH

NADH-quinone oxidoreductase subunit H

346 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

39.039 kDa

MNWNEILFWLLKSGLFFFILITACAYYTLAERKVAGFIQDRKGPNRAGIWGLLQPLADGIKFLTKEEVFPTQVNKIMYLIAPAISMTCAIMAWSVVPLGGRIPLPQWLQDRTGLVFLDLQIANPDTGILFLFAISSLAVYGIIIAGWASNNKYSLLGAIRSTAQMISYELPLSMSVVSIVILTGSLKLTDISASQAGLWNIFKLPGFIAFCLFVVAMFAETNRLPFDLAEAESELVVGFHTEYGAFKFALFFIAEYMNMITMSCVVTLLFFGGYQVPFGILEGHVLQSLFGLFFFLGKVLFFTFLFVWVRWTLPRFRYDQLMSLGWKKLIPWAVLNILIASLYIQF

nuoH

NADH-quinone oxidoreductase subunit H

345 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.371 kDa

MAEFFDTPGGIALIILAQVLAVVAFVMISLLFLVYGDRKIWAAVQMRRGPNVVGVYGLLQSVADALKYVVKEVVIPAGADRTVFILAPMTSFVLAMIAWAVIPFNDGWVLSDINVAILYVFAVSSLEVYGVIMGGWASNSKYPFLGSLRSAAQMISYEVSIGLIIIGVILSTGSMNFGDIVRAQDTGWGFFGWYWLPHFPMVFLFFISALAETNRPPFDLPEAESELVAGYQVEYSATPFLLFMAGEYIAIFLMCALTSLLFFGGWLSPIPGLPDGVLWMVAKMAFFFFIFAMVKAITPRYRYDQLMRLGWKVFLPFSLVWVVFVAFAAKFDWFWGAFARWSVGG

nuoH

NADH-quinone oxidoreductase subunit H

345 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.546 kDa

MAEFFNTPGGIAVIILAQTLAVVAFVMISLLFLVYGDRKIWAAVQMRRGPNVVGVYGLLQTVADALKYVVKEVVIPAGSDRTVFILAPLTSFVLAMIAWAVIPFNDTWVLSDINVAILYVFAVSSLEVYGVIMGGWASNSKYPFLGSLRSAAQMISYEVSIGLIIIGVILSTGSMNFGDIVRAQDGDAGLFNWYWLPHFPMVFLFFISCLAETNRPPFDLPEAESELVAGYQVEYSSTPFLLFMAGEYIAIFLMCALTSLLFFGGWLSPVPFLPDSPLWMVAKMAFFFFLFAMVKAITPRYRYDQLMRLGWKVFLPFSLIWVVFVAFAARFEWFWGAFARWSTGG

nuoH

NADH-quinone oxidoreductase subunit H

345 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.613 kDa

MIPSMVWTALGAFLVINAMLLSASLLVFAERRVSAFIQNRPGPNRVGPLGLLQPFADVLKFVLKEDVQPAQSNKFIHSMAPVVMVVIAMTTASLIPFAEGVVVADLNVGVIMLLALTSISVYGVTLAGWSSNSKFSLLGGLRSAAQMVSYELSMGLAVISVVLIAGSLNFMEIVEHQSSGGALLGWNAVRNPIGCLIFIVTAFAETNRAPFDLPEAEEELVAGYHTEYSGMKFGMFFLAEYVNWFIASFFIVTLFFGGYLVPLEPQLIALFPALEGSTLLALLQFVSLMLKVSFFSFVFIWVRWTFPRFKYNQLMKVGWKYLLPIALANAILIALGVVLFGAVGL

nuoH

NADH-quinone oxidoreductase subunit H

345 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.014 kDa

MADFFSTGPGIAVLIIAQCLAVLGFVMVSLLFLVYGDRKIWAAVQMRRGPNVVGAFGLLQTVADALKYVVKEVVVPAGADKPVFMLAPMTSFVLAMIAWAVIPFNDGWVLADINVAILYVFAVSSLEVYGVIMGGWASNSKYPFLGSLRSAAQMISYEVSIGLIIIGVILSTGSMNFSAIVAAQDGDFGFFSWYWLPHLPMVFLFFISALAETNRPPFDLPEAESELVAGYQVEYSSTPFLLFMAGEYIAIFLMCALITLLFFGGWLSPIPFLPDGPIWMVGKMAFFFFLFAMVKAIVPRYRYDQLMRLGWKVFLPFSLAWVVFVAFAAQFELFGGAYARWAIGG

nuoH

NADH-quinone oxidoreductase subunit H

345 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.852 kDa

MADFWATSLGQTLILLAQGLGIIAFVMIGLLLLVWGDRKIWAAVQMRKGPNVVGAFGLLQSVADAAKYVFKEIVVPAGVDKPVYFLAPMLSLVLALLAWVVVPFNEGWVMADINVAVLFVFAVSSLEVYGVIMGGWASNSKYPFLGSLRSAAQMISYEVSMGLIIVGVIISTGSMNLSAIVEAQRGDFGLLNWYWLPHLPMVALFFISALAETNRPPFDLPEAESELVAGFMVEYSSTPYLLFMAGEYIAVWLMCALTSVLFFGGWLSPIPGVPDGVLWMVAKMAAVFFVFAMVKAIVPRYRYDQLMRIGWKVFLPLSLAWVVVVAFLAKFEVLGGFWARWSIGA

nuoH

NADH-quinone oxidoreductase subunit H

345 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.258 kDa

MADFFTTPGGIAVLILAQVLAVIGFVMVSLLFLVYGDRKIWAAVQMRRGPNVVGTFGLLQTVADALKYVVKEVVVPAGADKTVFMLAPMTSFVLALLAWAVIPFNDGWVLSDINVAILFVFAISSLEVYGVIMGGWASNSKYPFLGSLRSAAQMISYEVSLGLIIIGVIISTGSMNFGGIVAAQDGPYGFFSWYWLPHFPMVFLFFISCLAETNRPPFDLPEAESELVAGYQVEYSSTPFLLFMAGEYIAIFLMCALTSLLFFGGWLSPIPGLPDGVFWMIAKMAFFFFLFAMVKAITPRYRYDQLMRLGWKVFLPFSLVWVVFVAFAAKFEWFWGAYARWGMGG

nuoH

NADH-quinone oxidoreductase subunit H

345 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.841 kDa

MAEFWASPYGFALSMLLQGLAVIAFVMGSLIFMVYGDRKIWAAVQMRRGPNVVGPWGLLQTFADALKYIVKEIVIPAGADKFVYFLAPFLSMMLALFAFVVIPFDEGWVMANINVGILFIFAASSLEVYGVIMGGWASNSKYPFLASLRSAAQMISYEVSLGLIIIGIIISTGSMNLTAIVEAQRGDYGLLNWYWLPHLPMVVLFFVSALAECNRPPFDLVEAESELVAGFMTEYSSTPYLLFMAGEYIAMYLMCALLSLLFFGGWLSPVPFIADGWWWMVIKMWFWFYMFAMVKAIVPRYRYDQLMRIGWKVFLPLSLGWVVLVAILARYEILGGFWARFAVGG

nuoH

NADH-quinone oxidoreductase subunit H

343 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.614 kDa

MEAGIVEAAGMDWEAFQTVAWTLVKIMALVVPLMLGVAYLTYAERKIIGWMQVRIGPNRVGFQGLLQPIADAVKLLMKEIIIPSGASRALFILGPILAIAPALAAWAVIPFSDGLVLADINAGLLYVMAITSMGVYGVIIAGWASNSKYAFLGAMRSAAQIVSYEIAMGFALVGVLMASQSLNLSAIVQGQAGGIQQWYLWPLFPLFVVYLVAGVAETNRAPFDVAEGESEIVAGFHVEYSGMAFAVFFLAEYANMILVAALTTLMFLGGWLSPVAFLPDGIVWWLLKTGFVLFLFLWFRATFPRYRYDQIMRLGWKVFIPITIVWIVFVGGMMQTPYGHLFH

nuoH

NADH-quinone oxidoreductase subunit H

343 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.352 kDa

MDSAFIIEKSVVIVAVFALTMLMAMYSTWAERKVAAFLQDRVGPNRAGWGGLLQPLADGLKLFSKEEFEPNTPNKFLFVVGPAIAMSTALMTSAVIPWGDKLHLFGRDILLQATDIDNALLYIFAVVSVGVYGIMIGGWASNNKFSLMGAVRAASQMVSYEVAMGLSMIALLMMTGTLSLKEISAQQSGMNWNVFYQPVSFLIFLICAFAETNRTPFDLAECESELIGGYHTEYSSMKMGFYLFAEYANMFISSAILAILFFGGYNYPGMQWMVENVGVNTANILGFLALFIKICGFIFFYMWVRWTIPRFRYDQLMHLGWRILIPLAILNIMVTGICLLLFK

nuoH

NADH-quinone oxidoreductase subunit H

343 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.976 kDa

MAEFISSIQAMGVAYLGETLWTLVWTILKIAVLIAPILFCVTYLTLAERRLIGFMQVRLGPNRVGVFGILQPLADAVKLFVKETMLPAKAHRTMFILAPILTFSTALVSWAVVPFSPELVLADVNVGVLFILAMSSLGAYGVLLSGWASNTRYSLLGGLRSAAQMISYEVSMGFTLVPVIMLSGSLNLGDIVESQKGLWYALPLLPGFFIYFISVVAETNRAPFDLPEAEAELVSGFCTEYSAMTYGMFFLGEYANIIMVSVLGSLMFLGGWLPPIEALSFIPGIVWLILKTGVLIFFFLWLRATFPRYRYDQLMRLGWKVFLPISLAWIFIVGLAMHLLDMA

nuoH

NADH-quinone oxidoreductase subunit H

342 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.661 kDa

MSGMHDFLFNTNLGLLIITALQALAILVPLMLMVAYATVFERKVLAAIGLRKGPNVVGPWGMLQAFADAGKMLLKETIIPDGANKVLFILAPLLTFILAMIAWAVVPVNDGWAVANINVGVLYLFAISSLGVYGVIIAGWASNSKYAFLGALRAAAQMVSYEVSIGFVMVAILLCVGSLNLNDVVLAQKHVWFVLPMLPMAVIFFISGLAETNRSPFDIVEGESEIVAGHMVEYSAMAYALFFLGEYANMFMICAMTTLLFLGGWLPPFDIVPLNWVPGPIWFVLKVCALMFVFFWVRGTVPRYRYDQLMRLGWKVFLPFSLVWLLLTACVLELAGWLPTVN

nuoH

NADH-quinone oxidoreductase subunit H

341 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.57 kDa

MDWQRLIVSYLVGFVLLNVLLGLMAYMTWFERRVLARMQHRVGPNRTGPFGLLQPIADGIKLLAKEDIVPANADRLVFLVAPLLSFALAPLGAAVIPFGDTLQLFGIEIPLLVADINVAVLYVLALGSVGVYGIILGGYASGNRYSLLGALRSTAQVISYELVLGLSLVGVFILSGSLSLQDILREQQRMLVLGPLTLPNWYILSQPLAFALFLIAAVAETNRAPFDLPEAETELVAGYFTEYSGFRFSFYFLAEYINMIVVSLLAATLFLGGIDGPFADGVWWLALKALFFLFFYVWLRATLPRFRYDQLMGLAWKVLLPLALLNIGLTGLVRLWGIGAL

nuoH

NADH-quinone oxidoreductase subunit H

341 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.836 kDa

MNTLVNILFILVPLLLSVAYLTYFERKVLAAIQLRHGPSVVGPFGLLQPFADAIKLLIKEPIIPFRASTILFIMAPMLTFILALIAWAVIPFGAEVIVENGQQVIIPKVIANINVGVLYVLAISSLGVYGVIIAGWSSNSNYAFLGAIRSAAQMISYEVSIGLIVAAVVITTGTLNLGEMVVAKHNMPFWVDLLLMPIGIIFFISLLAETNRHPFDLPEAEAELVSGYNVEYSSMPFALFFLGEYANMILASAMMTIFFLGGWYPPLEFSLLYKIPGLIWFVLKIVILLFIFIWIRATIPRYRYDQLMRLGWKVFLPISVLWVILISGVLLFTGNLPGSNV

nuoH

NADH-quinone oxidoreductase subunit H

341 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.937 kDa

MNTLVNILFIMIPLLFSVAYLVYFERKVIGAIQLRHGPSVVGPFGLLQPFADAIKLLVKEPIIPFRANTILFIMAPMLTFILALIVWAVIPFGAEVITENGQQIVIPKVIANVNIGVLYVLAISSLGIYGIIVAGWSSNSNYAFLGSIRSAAQMISYEVSMGLIVATVVITTGTLNLGEMVATKHSMPFWIDLLMMPIGVVFFISLLAETNRHPFDLPEAEAELVSGYNVEYSSMPFALFFLGEYANMILGSAMMTIFFLGGWYPPLKLSLLYKIPGLIWFVLKIVLLLFIFVWTRATIPRYRYDQLMRLGWKVFLPISVLWVILISGVLLFTGNLPGRGL

nuoH

NADH-quinone oxidoreductase subunit H

341 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.778 kDa

MVDLLTGLLPPFVWRLLIIVLQIVAIVLPLLIAVAYLTYAERKVIGAMQLRKGPNVVGPFGLLQPMADGLKLFVKETVLPTSANRVVFVGAPMLTFFLALVAWAVIPFDKGWVLADINVGVLYLFAISSLGVYGIIMAGWASNSKYAFLGGLRSAAQMVSYEVSIGFILISVLLTVGSLNLSDVVTAQSKMWFIVPHFPLFILFIISGLAETNRAPFDLPEAEAELVAGYNVEYSAMTFALFFLGEYANMLMMGAMTSILFLGGWMAPFGLGWLPIPGLIWFVLKICLVMFVFLWVRATFPRYRYDQLMRLGWKVFLPFSLFWLVLTASVLTAFGWLPNQG

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.989 kDa

MQLVGMVALMVGVLVSVAYLVYMERKVMAFMQLRHGPSVVGPWGLLQPFSDALKLLAKECIIPFKSRGWAFFAAPVITFALALAGWAVIPLGATEVIRDGVVVVMPYVVADLNLGVLYVLAISSLEVYGIIMAGWASGSNYAFLGAIRSVSQMISYEMSMGLVMLSVSLCAGSLRLTDIVVARHAMPYWMDLLLLPMAGVFFVSMLAETNRHPFDLPEAESELVSGYNVEYSSMSFAMFFLGEYANMILVSAMMVVLFLGGWYPPLNIHILYYIPGFVWFCSKVFLLLFCFIWVRSTVPRYRYDQLMRLGWKVFLPFSFVWVMVISGVLLWVKALPGMQN

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.02 kDa

MLHTIGILIWIIIKILVIVVPLLLSVAYLTYAERKVIGYIQVRIGPNRVGLKGLLQPFADLLKLITKEIIVPTRSNKYLFVIAPLFALVPSLVGWAVIPFQEGVVLANINAGVLYLFAMSSLGVYGVLIAGWASNSKYAMFGALRSTAQTVSYEIAMGFALVGVLLAAGSMNLTDIVNSQKGGMLHWWFIPLLPLFLVFWIAGIAETNRAPFDLAEGESEIVAGFHVEYSGIGFALFFLSEYASMILISTFMAILFMGGWLSPFEGITFLDQIFFVVPGFVWLLLKISFFLFVYLWVRATFPRYRYDQLMRLGWKVLIPVTIVWLVVTSLMVVAHVKPWF

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.034 kDa

MLHTIGILIWIIIKILVIVVPLLISVAYLTYAERKVIGYIQVRIGPNRVGLKGLLQPFADLLKLITKEIIVPTRSNKYLFVIAPLFALVPSLVGWAVIPFQEGVVLANINAGVLYLFAMSSLGVYGVLIAGWASNSKYAMFGALRSTAQTVSYEIAMGFALVGVLLAAGSMNLTDIVNSQKGGMLHWWFIPLLPLFLVFWIAGIAETNRAPFDLAEGESEIVAGFHVEYSGIGFALFFLSEYASMILISTFMAILFMGGWLSPFEGITFLDQIFFVVPGFVWLLLKISFFLFVYLWVRATFPRYRYDQLMRLGWKVLIPVTIVWLIVTSLMVVAHVKPWF

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.996 kDa

MLHTIGILIWIIIKILVIVVPLLISVAYLTYAERKVIGYIQVRIGPNRVGLKGLLQPFADLLKLITKEIIVPTRSNKYLFVIAPLFALVPSLVGWAVIPFQEGIVLANINAGVLYLFAMSSLGVYGVLIAGWASNSKYAMFGALRSTAQTVSYEIAMGFALVGVLLAAGSMNLTDIVNSQKGGMLHWWFIPLLPLFLVFWISGIAETNRAPFDLAEGESEIVAGFHVEYSGIGFALFFLSEYASMILISTVLAILFMGGWLSPFEGITFLDQIFFIVPGFVWLLLKISFFLFVYLWVRATFPRYRYDQLMRLGWKVLIPVTIVWLIVTALMVVAHVKPWF

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.968 kDa

MLHTIGILIWIIIKIIVIVVPLLISVAYLTYAERKVIGYIQVRIGPNRVGLKGLLQPFADLLKLITKEIIVPTRSNKYLFVIAPLFALVPSLVGWAVIPFQEGVVLANINAGVLYLFAMSSLGVYGVLIAGWASNSKYAMFGALRSTAQTVSYEIAMGFALVGVLLAAGSMNLTDIVNSQKGGMLHWWFIPLLPLFLVFWISGIAETNRAPFDLAEGESEIVAGFHVEYSGIGFALFFLSEYASMILISTVLAILFMGGWLSPFEGITFLDQIFFIVPGFVWLLLKISFFLFVYLWVRATFPRYRYDQLMRLGWKVLIPVTIVWLIVTAVMVVAHVKPWF

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.995 kDa

MTDQLITLIWIIIKIVLILVPLLVAVAFITLAERKVIGYMQSRVGPNRVGFRGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQGWVLANVNAGLLFLFAMTSLGVYGILVAGWASNSKYAFFGALRSAAQVVSYEIPMGFALVGVLLAAGTMNLQGIVLRQSGGLWHWFWLPLLPLFVTYWITAVAETNRAPFDVAEGESEIVAGFHVEYAGVTFALFFLAEYANMVLVSAIATVIFLGGWLSPFQGIPGLESLFAWVPGIVWFVLKLSLFIFTYFWMRATFPRYRYDQIMRLCWKVLIPVTLVWIIILALAIEFHWTHWL

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.027 kDa

MTDQLITLIWIIIKIVLILVPLLVAVAFITLAERKVIGYMQSRVGPNRVGFRGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQGWMLANVNAGLLFLFAMTSLGVYGILVAGWASNSKYAFFGALRSAAQVVSYEIPMGFALVGVLLAAGTMNLQGIVLRQSGGLWHWFWLPLLPLFVTYWITAVAETNRAPFDVAEGESEIVAGFHVEYAGVTFALFFLAEYANMVLVSAIATVIFLGGWLSPFQGIPGLESLFAWVPGIVWFVLKLSLFIFTYFWMRATFPRYRYDQIMRLCWKVLIPVTLVWIIILALAIEFHWTHWL

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.995 kDa

MTDQLITLIWIIIKIVLILVPLLVAVAFITLAERKVIGYMQSRVGPNRVGFRGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQGWVLANVNAGLLFLFAMTSLGVYGILVAGWASNSKYAFFGALRSAAQVVSYEIPMGFALVGVLLAAGTMNLQGIVLRQSGGLWHWFWLPLLPLFVTYWITAVAETNRAPFDVAEGESEIVAGFHVEYAGVTFALFFLAEYANMVLVSAIATVIFLGGWLSPFQGIPGLESLFAWVPGIVWFVLKLSLFIFTYFWMRATFPRYRYDQIMRLCWKVLIPVTLVWIIILALAIEFHWTHWL

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.995 kDa

MTDQLITLIWIIIKIVLILVPLLVAVAFITLAERKVIGYMQSRVGPNRVGFRGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQGWVLANVNAGLLFLFAMTSLGVYGILVAGWASNSKYAFFGALRSAAQVVSYEIPMGFALVGVLLAAGTMNLQGIVLRQSGGLWHWFWLPLLPLFVTYWITAVAETNRAPFDVAEGESEIVAGFHVEYAGVTFALFFLAEYANMVLVSAIATVIFLGGWLSPFQGIPGLESLFAWVPGIVWFVLKLSLFIFTYFWMRATFPRYRYDQIMRLCWKVLIPVTLVWIIILALAIEFHWTHWL

nuoH

NADH-quinone oxidoreductase subunit H

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.995 kDa

MTDQLITLIWIIIKIVLILVPLLVAVAFITLAERKVIGYMQSRVGPNRVGFRGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQGWVLANVNAGLLFLFAMTSLGVYGILVAGWASNSKYAFFGALRSAAQVVSYEIPMGFALVGVLLAAGTMNLQGIVLRQSGGLWHWFWLPLLPLFVTYWITAVAETNRAPFDVAEGESEIVAGFHVEYAGVTFALFFLAEYANMVLVSAIATVIFLGGWLSPFQGIPGLESLFAWVPGIVWFVLKLSLFIFTYFWMRATFPRYRYDQIMRLCWKVLIPVTLVWIIILALAIEFHWTHWL

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.603 kDa

MAVFTELFWITLKIMALVVPLMLAVAYLTYAERRVIGAMQDRRGPNRVGYQGLLQPIADALKLVMKEISIPSNANRVLFVIAPLLAIMPALAAWAVIPVAEGWAIADINAGLLYILAMTSLGVYGIIIAGWASNSKYALLGTLRASAQVVSYEIAMGFALVGVLMAAGSMNLGQIIQAQAGGIFHWFWLPLLPLFLVYWISGVAETNRAPFDVAEGESEIVAGFHVEYSGTSFAVFFLAEYANMILISAVAAVMFLGGWYSPFHGWPILGPMLDWVPGVVWFMLKTAFFMFCYLWFRATFPRYRYDQIMRLGWKVLIPVTVVWLIVLTIFIVTGFGPWF

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.579 kDa

MIAEMQTMLGPLWPVAWNLLKIIAIVGPLMGAVAYLTLAERKVIGFMQVRMGPNRVGYRGLLQPLADGVKLLMKEIIIPSAASRTLFLLGPVLAIAPALAAWAVVPFDLTLVLADIDAGLLYILAMTSVGVYGVIIAGWASNSKYAFLGAMRSAAQIVSYEIAMGFALVGVLMSANSLNLGKIVLAQSGGFWEWYWLPLFPLFIVYFISAVAETNRAPFDVAEGESEIVAGFHVEYSGMAFAVFFLAEYANMILVAMLAALMFLGGWLSPVPFLPDSILWLLFKVAALLFFFLWFRATFPRYRYDQIMRLGWKVFIPVTLVWILFVGAMMQTRWAYLFH

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.116 kDa

MLELFFEYIFPLIIIALKVVAITIPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSEIIEVQRTMPWWIDLMLLPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLVYTDNLPSI

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.092 kDa

MTDFFFEYIFPLIIIALKVVAITIPLILCVAYLTYAERRVIGLMQLRCGPNVVGPFGLLQPIADAVKLLFKEPIIPINADKILFILAPMITFILSLIGWAVIPFSKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGFVIITVLLTTGTLNLSGIIEAQRTMPWWIDLMLLPMGIVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLFYTDNLPNV

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.058 kDa

MIELFFEYIFPLIIIALKVVAITIPLILCVAYLTYAERRVIGLMQLRCGPNVVGPFGLLQPIADAVKLLFKEPIIPTNADKILFVLAPMITFILSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSQIVEAQRTMPWWIDLMLMPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLIYTDHLPNV

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.111 kDa

MIELFFEYIFPLIIIALKVVAITIPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNADKILFVLAPMITFILSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSQIVEAQRTMPWWIDLMLMPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLIYTDHLPNV

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.953 kDa

MTSLFFEYTFPLIIIALKVVAITVPLILCVAYLTYVERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNSDRILFILAPMITFILSLIGWAVVPFAKGLVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSGIIEAQRTIPWWIDLMLLPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFAFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVLLPLTLFWVVLVSSVLMYTDHLPSV

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.061 kDa

MLELFFEYIFPLIIIALKVVAITIPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEMSMGLVIITVLLTNGTLNLSGIIEAQRTMPWWIDLMLLPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLVYTDNLPSI

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.051 kDa

MTELFFEYIFPLIIIALKVVAITIPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSGIIEAQRTMPWWIDLMLLPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDFIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLVYTDNLSNV

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.805 kDa

MIEYFCEYMFPLTVIALKVVAITIPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTDADKILFILAPIITFVLSLIGWAVIPFSSGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSGIIEAQKTLPWWIDLMLLPMSIVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTLFLGGYLPPFNLSFLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPFTLFGVVLVSSVLFYTDNLPSV

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.076 kDa

MLELFFEYIFPLIIIALKVVAITTPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSEIIEAQRTMPWWIDLMLLPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLVYTDNLPSI

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.054 kDa

MLELFFEYIFPLIIIALKVVAITIPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNADKILFILAPMITFILSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSEIIEAQRTIPWWIDLMLLPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLVYTDNLPSI

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.054 kDa

MLELFFEYIFPLIIIALKVVAITIPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNADKILFILAPMITFILSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGLVIITVLLTTGTLNLSEIIEAQRTIPWWIDLMLLPMGVVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWFVFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLVYTDNLPSI

nuoH

NADH-quinone oxidoreductase subunit H

339 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.923 kDa

MIELFYEYMFPLTVIALKVVAITIPLILCVAYLTYAERRVIGLMQLRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNADKILFILAPIITFVLSLIGWAVIPFAKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSIGLVIVTVLLTTGTLNLSRIIEAQKTLPWWIDLMLLPMSIVFFISVLAETNRLPFDLPEAESELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNLPFLDCIPGFFWFVLKVMLLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFGVVLVSSVLFYTDNLPSV

nuoH

NADH-quinone oxidoreductase subunit H

338 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.712 kDa

MNQEIIRQTPLWAENWPIAYAVVQAVVILLVVVLVAALMSFIERRLLAWWQDRYGPNRVGPGGMFQIVADMLKIMFKEDWTPKFADKLTFRLAPAVAMATAVLSFMVIPVSPALGVADMSIGLLFFMAMAGIAVYAVLFGGWSSNNKYSLLGGLRSAAQTISYEVFLGISLMGVVAIAGSFNLREIVEAQRDVWFIIPQFLGFLIFVVAGVAVTHRHPFDQPEAEQELAEGYHVEYGGMKWGMFFVAEYVNVVLISALIVTLFFGGWLAPFNLEIPFVPPVFWFVIKTAFFVMMFVLARGSLMRPRYDQVMNFGWKICLPLALVNLLVTGAVILMNQA

nuoH

NADH-quinone oxidoreductase subunit H

337 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.433 kDa

MYETLFWQFAKIWAVLIPLFLAVAYFTYVERRVIGHMQDRRGPNRVGPRGLLQPIADALKLLFKEITIPTYASRTLFLIAPAMAIMPALAAWAVIPFDDGLVVADINAGLLYILAMTSLGVYGLIIAGWASNSKYALLGTLRASAQVVSYEIAMGFALVGVLIAAGTMNLSGIVHAQAGPFWEWFWLPLLPLFLIYWISGVAETNRAPFDIAEGESEIVAGFHVEYSGMAFAVFFLAEYANMLLISFLAATLFLGGWHSPFEGLPVLGPAFDWVPGIVWLFAKAAFFAFCYLWFRATFPRYRYDQLMRLGWKVLIPGTVVWLVVLTGLVYGGVGPWF

nuoH

NADH-quinone oxidoreductase subunit H

337 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.32 kDa

MADFWGGYLWPAIIIVLQCLAIILPMLGAIAYLTYAERKVIGAMQMRKGPNVVGPFGLLQPLADGVKLFLKETIIPTGANRAVFIIAPLMTFILALIAWAVIPFDAGWVVADINVGVLYLFAVSGLGVYGIIMAGWASNSKYAFLGGLRSAAQMVSYEVAMGLIIIAVILSAGSMNLSDIVEAQRQGVWYFIPHFPMFVMFLVSILAETNRAPFDLPEAEAELVSGYNVEYSAMPFALFFLGEYGNMILMSGITAILFLGGWLPPVDIAPFNWIPGIIWFFLKIALILFVFLWVRATFPRYRYDQLMRLGWKVFLPGSLIWVVLTAGFLVTFDMLPR

nuoH

NADH-quinone oxidoreductase subunit H

337 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.12 kDa

MTDVLIAYGIPLAIIAAQSLALIVALLLVTAYVLLADRKIWAAVQLRRGPNVVGAFGLLQSFADLLKFVFKEIVIPAGANKGIFLLAPLVTVVLALSGWAVIPLDARMVIADINVGILYIFAISSLGVYGVIMAGWASNSKYPFLSALRAAAQMVSYEVSIGFVIVCVLMTAGSLNLTAIVESQRTIWYFIPHLPMFVIFFISALAETNRPPFDLAEAESELVAGFMVEYSSTAYMMFMLGEYVSILLMCAMTTILFLGGWLPPIDIAPFNMVPGVIWFLLKVFLVFFMFAMVKAFVPRYRYDQLMRLGWKVFLPISLFWVVLTAGVLVGFDIVPQH

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.923 kDa

MEAIAYSLAFTFLKIVIVFSLALGIGAYLTWFERKLAGHIQNRLGPTVVGKFGILQPLADALKLATKEVIIPRGADKPVYYAAVVMALVPSILLLTIIPFGPGFRVGNTYIEPIIADVNIALLLAFAFGSLSVYGTIFSGWASNSKYAFIGSLRKAAVVIAYEVVLGFSVLGVILLAGTLSTVGIVEAQIQKGVWFIFYQPVAFILYLFCMLAESGRVPFDIQEAEAELVTGYNVEYGGMKFGAFPLAEWYVNVIALSAIAVVLFFGGWDGPHIFGPLSPYFWFVFKTFALVFFTLWLHWTLPRFQAKDITEIAWKILLPIAILNVIITAVVVYAF

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.257 kDa

MLYLVLSKLVWIVLLAIVLILCVAYLTYAERKVIAATQLRVGPDLVGPFGLLQPIADAIKVLLKEIIIPNAASPKLFLFAPVIIFVLALVGWAVIPFGTSEIDGVEVPTVIANVNLGVMYLLGVAALEVYGTIIAGWASKSSYSFLGALRSASQMISYEIVIAPVVMTVILLTGSLNLAEIVVIKHSLPYWVDILMLPMTFIFFVSILAETNRHPFDLPEAEAELVSGYNVEYSSIPFALFFLGEYANMILSSSIMATLFLGGWYPPINWWGLSIVPGFIWFILKIVFVLFCFLIVRATLPRYRYDQLMRLCWKVFLPVTLLWIVVIGGLVAFNIV

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.717 kDa

MLEYILWTALYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSVYGIVIAGWASNSKYSLFGALRAGAQVVSYELAMGFAIVGVVIAAGSMGITGIIESQAGGLWHWYFIPLFPLFVVYFIAGIAETNRAPFDVVEGESEIIAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWCSPFEATPLEAVFNFVPGVVWLFAKTGIFMFMFLWVRATFPRYRYDQIMRLGWKIFIPLTFVWVVVVACMVRFGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.642 kDa

MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.642 kDa

MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.642 kDa

MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.632 kDa

MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFISLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.642 kDa

MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.642 kDa

MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.642 kDa

MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.642 kDa

MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.889 kDa

MADIWTDYGVPGAIIVAQILALMVPILVSVAFLVYAERKVLGLMQLRQGPNMVGPWGILQSFADALKMIGKETIIPAGANRIIFLAAPMLTMMLALAAWAVIPFGEGLVISDINVGILYLLAISSQGVYGIIMAGWASNSKYAFLGGLRSAAQMVSYEVSIGLVIITVLLCVGSLNLSDVVEAQKTVWFAIPLLPMFVIFFISALAETNRAPFDLPEGESELVGGFHTEYSGMAFGLFFLGEYANMILMSAMTSVLFLGGWLPPLDVAPLNWVPGPIWFILKICFCLFLFVWVRATVPRYRYDQLMRLGWKVFLPFSLVWVILTAGVLVTFDWLPK

nuoH

NADH-quinone oxidoreductase subunit H

336 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.413 kDa

MMNTLLQQAPSWGTTLWFIIAAVLLLAVVLGFVTYAIYFERKVIGWMQLRIGPNRVGPLGLLQTVADVAKLLLKEDIRPQHADKALFTLAPILAYAPAFAVLAVMPFTDSIRFADLGIGLLYYIALSGITVLGVITAGWASNNKYSLIGGLRSAAQMISYEVPLVMSVVGIVLLTGSMNLKDIVEAQRDVWNIVPQFIGFAVFIIAAQAELNRTPFDLPEAESELVGGYHVEYSGFRFAMFMLAEYVYMFGMGALITILFFGGWLPIHPSLDFIPGIVWFILKFSVYVFLQFWIRATMPRLRVDQLMSFAWKVLLPVALFNILLTAVVVSYQNGMF

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.636 kDa

MSWFTPEVIDVILTVVRAIVVLLAVVVCGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWNPPFVDRMIFTLAPVVAMSALLIAFVVIPITPLWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKYALLGSLRASAQTVSYEVFLGLALMGVVVQVGSFNMRDIVEYQANNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFGILPQVPFLWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAVVLYNTPAVAAQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.562 kDa

MSWFTPEVIDVILTVVKAIVILLAVVIAGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAIIPITPTWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKFALLGSLRASAQTVSYEVFMGLALMGIVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFGILPQLSFVWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLITAAVVLWNTPAVAVQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.555 kDa

MTWFTPEVIDVIISVVKAIVILLAVVVAGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAVIPITPTWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKFALLGSLRASAQTVSYEVFMGLALMGIVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFGILPQLAFFWFFLKTAFFIMLFILLRASIPRPRYDQVMDFSWRFCLPLTLINLLVTAAVVLLNTPAAAVQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.638 kDa

MSWFTPEVIDVILTVLRAIVVLLAVVVCGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWNPPFVDRVIFTLAPVVAMSALLIAFVVIPITPTWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKYALLGSLRASAQTVSYEVFLGLALMGVVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFGILPQLSFLWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAIVLYNTPAVAAQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.558 kDa

MTWFTPEVIDVILTVIKAIVILLAVVVAGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAIIPITPTWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKFALLGSLRASAQTVSYEVFMGLALMGIVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFGILPQLSFVWFALKTAFFILLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAIVLWNTPAVAVQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.567 kDa

MSWFTPEVIDVIIQVVKAIVVLLAVVVCGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWNPPFVDKMIFTLAPVVAMSALLIGFSIIPITPGWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKYALLGSLRASAQTVSYEVFLGLALMGVVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFGILPQVPFLWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAIVLYNTPAVAAQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.638 kDa

MSWFTPEVIDVILTVLRAIVVLLAVVVCGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWNPPFVDRVIFTLAPVVAMSALLIAFVVIPITPTWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKYALLGSLRASAQTVSYEVFLGLALMGVVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFGILPQLSFLWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAIVLYNTPAVAAQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.567 kDa

MSWFTPEVIDVIIQVVKAIVVLLAVVVCGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWNPPFVDKMIFTLAPVVAMSALLIGFSIIPITPGWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKYALLGSLRASAQTVSYEVFLGLALMGVVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFGILPQVPFLWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAIVLYNTPAVAAQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.443 kDa

MTWFTPDVIDAIIAVVKAIVVLLAVVVCGALLSFVERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAVIPITPTWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKFALLGSLRASAQTVSYEVFMGLALMGIVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFDILPSLAFFWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAIVLLNTPAGSVQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.457 kDa

MTWFTPDVIDAIIAVVKAIVVLLAVVVCGALLSFIERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAVIPITPTWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKFALLGSLRASAQTVSYEVFMGLALMGIVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFDILPSLAFFWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAIVLLNTPAGSVQ

nuoH

NADH-quinone oxidoreductase subunit H

335 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.457 kDa

MTWFTPDVIDAIIAVVKAIVVLLAVVVCGALLSFIERRLLGWWQDRYGPNRVGPFGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAVIPITPTWGVADLNIGLLFFFAMAGLSVYAVLFAGWSSNNKFALLGSLRASAQTVSYEVFMGLALMGIVVQVGSFNMRDIVEYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFVGEYIGIILISALLVTLFFGGWHGPFDILPSLAFFWFALKTAFFIMLFILLRASIPRPRYDQVMDFSWKFCLPLTLINLLVTAAIVLLNTPAGSVQ

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.664 kDa

MMEQLLQSTPSWTNVAIFFAIGVGLLLVVLGFVTYGILAERKVMGFMQGRIGPNQVGGRWGLLQTVADVLKLLLKEDTIPKAADRPLFILAPVIAFAPAFMVLAALPFTDALQFADIGVGLLYYIAVSGLTTIGVVTGAWASNNKYALLGGMRAAAQMISYEVPLVMSVIGVILLSGSLNLNDIVAAQKDVWFIVVQPIGFLVFLIAAVAELNRTPFDLPEAESELVAGFHVEYSGFRWAFFMLAEYVYFFAMAALTTVLFLGGWHPLPFLGFIPGAVWFALKFSLVVFLFIWFRITFPRVRADQLMEFGWKVLLPVALVNIFVTALVKQLFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.909 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQEKVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.909 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQEKVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.001 kDa

MVERLLESSASWSNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRVGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPIIAFAPAFMVLAVIPFTSQFQFADIGVGLLYYIAISGITTIGVLTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLTGSLNLNEIVASQEKVWYIFAQPIGFIIFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLAEYVYLFGMASLMTVLFLGGWNPVLFLDFIPGAVWFALKFSAVVFLFIWFRVTFPRMRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.909 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQEKVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.224 kDa

MRQTPLWAENWPIAYSVIQAIVILLVVVLVAALMSFIERRLLAWWQDRYGPNRVGPGGMFQIVADMLKIMFKEDWTPKFADKLTFRMAPAVAMATAVLSFIVIPVSPTLGVADMSIGLLFFMAMAGIAVYAVLFGGWASNNKYSLLGGLRSAAQTISYEVFLGISLMGVVAIAGSFNLREIVEAQRDMWFIVPQFLGFMIFVVAGVAVTHRHPFDQPEAEQELAEGYHVEYGGMKWGMFFVAEYVNIVLISALIVTLFFGGWLAPFNLEIPFIPPVFWFIVKTAFFVMMFVLARGALMRPRYDQVMNFGWKVCLPLALVNLMVTGAVILMNQA

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.895 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.881 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPVGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.911 kDa

MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGVVLLAGSLNLNEIVAAQEKVWYIFAQPIGFVIFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMSSLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKILLPIALANIFLTALIKELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.627 kDa

MMEQWLESTPGWSNIALFFGLGALLLAVVLAFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDTIPKAADRPLYVLAPIIAFVPSFMVLAVLPFTDAFRFADIGVGLLYYIAVSGLTTVGVVAGGWASNNKYALLGGMRAAAQMISYEIPLVMSALGVVLLAGSMNLVDIVAAQKDVWFIFAQPLAFLIFLIAAVAELNRTPFDLPEAESELVAGFHVEYSGFRWAFFMLAEYVYLFAMAALVTILFLGGWHPVAFLGWIPGAVWFALKFCAVVFVLIWFRATFPRVRADQLMEFAWKVLLPLSLVNIVLTAVVKAWFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.987 kDa

MMEQLLNSAPSWTNLVIFFGLGLALLFAVLAFVTYGILAERKVMGFMQGRYGPNQVGGRWGLLQTVADVLKLLLKEDTIPKAADKPLFILAPIIAFAPAFMVLATLPFTDAFQFADIGVGLLYYIAVSGLTTIGVVAGGWASNNKYALIGAMRAAAQMISYEIPLVVSVLGVVLLTGSLNLNDIVEAQKDVWYIFIQPIAFIVFFIAAVAELNRTPFDLPEAESELVAGFHVEYSGFRWAFFMLSEYVYLFAMAALTTILFLGGWHPVMFLDFIPGAVWFALKFSIVVFVLIWFRVTFPRLRADQLMELGWKVLFPVALLNIFVTALIQELFF

nuoH

NADH-quinone oxidoreductase subunit H

333 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.841 kDa

MSLTLINVLAAALIALAFVAVNAAYLVWAERRGAAFIQRRLGPVENGPWGLLQPPVDGIKLMTKQLVIPGGVDKILFMVAPVLAMFPALMSFVTIPFSENIVAHNMDIGLLVILAFASFAGLAILLAGWSSRNKYSMMAAIRAVSQTIAYEIPMLITAITVVLVSGSVDFIEIVHSQSGGFWHWNLWPLKPGLFNIFMPISFLIFFICSLAETNRAPFDLGEAESELVAGFHTEYSSMGFGLFFMGEYANIVIGACLTTLLFLGGWDCPFGLFPGVWWFLIKIYILIFTFIWIRWTFPRTTIYGLLNLSWKILIPLSLINLLLTAGFIKVFAP

nuoH

NADH-quinone oxidoreductase subunit H

332 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.