nuoD

NADH-quinone oxidoreductase subunit D

482 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

52.199 kDa

MTTNTSTSSTTDDLTTGAPNGTGAPDGANGVGGPTGTVGGPGEHPAYEAGFTESANGRVYTVTGSDWEQILGVGEEENERIVVNMGPQHPSTHGVLRLVLEIEGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADYLSPLFNEAAYCLSVERLLGITEQVPERATVIRVMVMELQRIASHLVWLATGGMELGATTAMIFGFREREKVLDLLELITGLRMNHAYIRPGGLAQDLPDGAERAIRAFLADMPKRIREYHALLTGQPVWKARMVDVNVLDAAGCIALGTTGPVLRAAGLPWDLRKTMPYCGYETYEFDVPTALEGDSFARYLVRLEEMGESLKIVDQCLDRLRPGPVMVADKKIAWPSQLSVGSDGTGNSLAYIRKIMGTSMEALIHHFKLVTEGFRVPAGQVYTQIESPRGELGYHVVSDGGTRPFRVHVRDPSFVNLQAVPALTEGGQVADVIVGVASVDPVLGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

470 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

51.253 kDa

MTPSTSTPHTSTAPHTSTGQSTDGAAQPGDGSSAYEAGFTESASGRVYTVTGGDWEEILGAGEQDAERIVVNMGPQHPSTHGVLRLVLEIDGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADYLSPLYNEAAYCLSVEKLLGITDDIPERATVIRVLVMELQRIASHLVWLATGGMELGATTAMIFGFREREKVLDLLELITGLRMNHAFIRPGGLAQDLPDGTERAIREFLADMPKRIREYHRLLTGQPIWKARMVDVNVLDAAGCIALGVTGPVLRAAGLPWDLRKTMPYCGYETYEFDVPTALEADSFARYLVRLEEMGESLKIIEQCLDRLRPGPVMVADKKIAWPAQLSIGADGMGNSLAHIRNIMGTSMEALIHHFKLVTEGFRVPPGQVYTQIESPRGELGYHVVSDGGTRPFRVHVRDPSFVNLQAVPALTEGGQVADVIVGVASVDPVLGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

457 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

50.258 kDa

MSTHTETPVDGSAETITGAQPYEAGFTESSAGRVYTVTGGDWEQVLGVGEDDGERITVNMGPQHPSTHGVLRLVLEIEGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADYLSPLYNEAAYCLSVEKLLGITGEVPERATVIRVLVMELQRIASHLVWLATGGMELGATTGMIFGFREREKILDLLETITGLRMNHAYIRPGGLAQDIPDEVIPEIRAFLDYMPKRIREYHALLTGQPIWKARMVDVNFLDAAACLALGTTGPVLRAAGLPWDLRKTMPYCGYETYEFDVPTALEGDSYARYLVRIEEMGESLKIIEQCLDRLRPGPVMVADKKIAWPSQLAIGSDGMGNSLEYIRKIMGTSMEALIHHFKLVTEGFRVPAGQVYTQIESPRGELGYHVVSDGGTRPFRVHVRDPSFVNLQAVPALTEGGQVADVIVGVASVDPVLGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

453 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

50.054 kDa

MKDTETRPGRHRAPEPAHPEQPDTTGDTVVTVSGQDWDTVTETLGGAREERIVVNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRTWMQGVTFVTRMDYLSPFYNETAYCLGVERLLGITEQIPERASIVRVLLMELNRISSHLVCLATGGMELGALTPMLFGFRERELILDVFETITGLRMNHAYIRPGGLAQDLPDDGVAKVRELLDLMPKRLRDMEHLLTQNPIFKARTQDIGYLDLTGCMALGITGPVLRSAGLPHDLRKSQPYCGYETYEFDVPTTTGCDCYGRYLIRVEEMKESLKIVEQCLDRLRPGPVMIEDKKLAWPADLKLGADGLGNSPAHIGRIMGSSMEGLIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAAMCEGGMVADVIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

451 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.794 kDa

MTTSAQRPERVIVVGGQDWDQVVTAARQMSNSSSRAGDAAEHAGERIVVNMGPQHPSTHGVLRLILEIEGETIVEARCGIGYLHTGIEKNLEFRTWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGVTDDIPERASVIRVMMMELNRISSHLVALATGGMELGAMTAMFLGFRERELILSVFETITGLRMNSAYIRPGGVAADLPEEGLPQIRELLTLLPTRLRDMENLLNENYIWKARTLGVGYLDLTGCMALGITGPVLRSTGLPHDLRKSQPYCGYQTYDFDVITDDRCDSYGRYLIRVKEMRESLRIVEQCVERLERSTGEPVMITDRKLAWPADLKVGPDGLGNSPEHIAKIMGHSMEGLIHHFKLVTEGIRVPPGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAAMCEGGMVADAITAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

451 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

51.38 kDa

MPQTQKPDFPGNDLGDQFRFWPKHNEKIYERLENKHAWLEEKRAAAQGDGKPPATQRSEVDPLENEMILNIGPQHPATHGVLRCVVKMDGETIEKSVLDIGYLHRGIEKLAEHKTYQEFMPYTDRMDYLSPYSNNVAWCLAVEKLADIEVPERAQWIRMIMSELARISSHCLWLGVGMMDAGAVSGFVWTFQEREEIYSIMDEVAGARFTVSHSRIGGVANDFSPRAIEMIRDFVDTFPDRIAGWEGLLNKNRIWVERNKGVGRVTKEEALELGLTGPNLRGSGVPYDVRRFEPYLKYDEVDFTIPVREEGDCLARYFLRLDEMKQSVRIIEQCLDRMTEGPIRSDDAKEAYPSKEEVYYSMEGMIHDFMYTDVGTVPPKGAHSYHAIEGPKGELGFYLTSDGTGRPWRVRINAPSFTNLQAMEHMLEGEMVADTVVIIGSLDPVMGEADK

nuoD

NADH-quinone oxidoreductase subunit D

449 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.798 kDa

MSTEPLADPAAGLGDPYAASSRETTEGRVYTVTGGDWDEFIDESAGEERIVINFGPQHPSAHGVLRLVFELEGETIVKARSVIGYLHTGIEKNVEYRTWTQGVTFVTRMDYLAPLHNETAYCMAVEKLLGVEAPPRAQTFRVMLMELSRIASHLVFLATGAMEMGATTGMTFGFREREEVLHLLEYLTGLRMNHAFVRPGGVAQDLPEDYRQKVLDFIKVMDSRLPSYDKLFTGQPIWKQRLKDVGYLPLDGCMQLGVTGPVLRSAGLAWDLRKVQPYCGYEDYEFEVPTSTGADCYARYLLRLEEMHQSLKIIRQCLDKMEPGPVMVSDAKIAWPAKLTIGPDGMGNSLEHVRKIMGQSMESLIHHFKLVTEGFDVPPGQVYVPVESPRGELGYHVVSDGGTRPMRVHVREPSFVNLQALPAMVEGGLMADAIASLASLDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

446 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.335 kDa

MADQDLYSGSSETTEGRVFTVTGQDWDSIAEGLAEDEAQERIVVNMGPQHPSTHGVLRLILELEGETVTEARAGIGYLHTGIEKNMEYRTWTQGVTFCTRMDYLSPFFNEMTYVLGIERLLDIEDRVPEKAQVMRVLLMELNRISSHLVAIATGGMELGALTVMTIGFRERELVLDLFELITGLRMNHAFIRPGGVAQDMPPGALDEIRGFVALMKKRLPEYADLCNANPIFKGRLEGIGHLDLAGCLALGLTGPVLRSTGYPWDLRKTQPYCGYETYDFDVQTWDTSDSYGRFRIRLNEMWESLRIIEQAADRLAGLDGAPVMIEDKKIGWPSQLAIGSDGMGNSLDHIRHIMGESMEALIHHFKLVTEGFRVPPGQAYVPVESPRGELGAHVVSDGGTRPFRAHFRDPSFTNLQATSVMAEGGMVADVIVAIASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

446 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.693 kDa

MTTPPGPPNAGGDARTGTDTVIVVGGEDWEQVVAAAEQAQAGERIVVNMGPQHPSTHGVLRLILEIEGETITEARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGVTDAIPERVNVIRVMLMELNRISSHLVALATGGMELGAMSAMFYGFREREEILSVFEMITGLRMNHAYIRPGGLAADLPDGAVPRIRELLALLPGRLRDLENLLNENYIWKARTQGIGYLDLAGCMALGITGPVLRSTGLPHDLRRAQPYCGYEDYEFDVITDDGCDAYGRYLIRVKEMRESLKIVEQCVDRLKPGPVMIADKKLAWPADLELGPDGLGNSPAHIARIMGQSMEGLIHHFKLVTEGIRVPAGQVYTAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAAMCEGGMVADAISAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

446 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.693 kDa

MTTPPGPPNAGGDARTGTDTVIVVGGEDWEQVVAAAEQAQAGERIVVNMGPQHPSTHGVLRLILEIEGETITEARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGVTDAIPERVNVIRVMLMELNRISSHLVALATGGMELGAMSAMFYGFREREEILSVFEMITGLRMNHAYIRPGGLAADLPDGAVPRIRELLALLPGRLRDLENLLNENYIWKARTQGIGYLDLAGCMALGITGPVLRSTGLPHDLRRAQPYCGYEDYEFDVITDDGCDAYGRYLIRVKEMRESLKIVEQCVDRLKPGPVMIADKKLAWPADLELGPDGLGNSPAHIARIMGQSMEGLIHHFKLVTEGIRVPAGQVYTAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAAMCEGGMVADAISAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

446 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.693 kDa

MTTPPGPPNAGGDARTGTDTVIVVGGEDWEQVVAAAEQAQAGERIVVNMGPQHPSTHGVLRLILEIEGETITEARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGVTDAIPERVNVIRVMLMELNRISSHLVALATGGMELGAMSAMFYGFREREEILSVFEMITGLRMNHAYIRPGGLAADLPDGAVPRIRELLALLPGRLRDLENLLNENYIWKARTQGIGYLDLAGCMALGITGPVLRSTGLPHDLRRAQPYCGYEDYEFDVITDDGCDAYGRYLIRVKEMRESLKIVEQCVDRLKPGPVMIADKKLAWPADLELGPDGLGNSPAHIARIMGQSMEGLIHHFKLVTEGIRVPAGQVYTAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAAMCEGGMVADAISAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

442 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.498 kDa

MSTSTVPPDGGEKVVVVGGNDWHEVVAAARAGAAAQAGERIVVNMGPQHPSTHGVLRLILEIEGEIITEARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDDIPERASVIRVMLMELNRISSHLVALATGGMELGAMSAMFYGFREREEILRVFESITGLRMNHAYIRPGGLAADLPDDAITQVRRLVEILPKRLKDLEDLLNENYIWKARTVGVGYLDLTGCMALGITGPILRSTGLPHDLRKAQPYCGYENYEFDVITDDRCDSYGRYIIRVKEMHESVKIVEQCLARLKPGPVMISDKKLAWPADLKLGPDGLGNSPEHIAKIMGRSMEGLIHHFKLVTEGIRVPPGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAATCEGGMVADAIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

442 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.728 kDa

MTTSQQPPERVVVVGGQDWDQVVAAARQNAAEHAGERIVVNMGPQHPSTHGVLRLILEIEGEIIVEARCGIGYLHTGIEKNLEFRNWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDAIPERASVIRVMMMELNRISSHLVALATGGMELGAMTAMFLGFRERELILSVFETITGLRMNNAYIRPGGVAADLPDEALPQVRDLLTLLPKRLRDMEDLLNENYIWKARTQGIGYLDLTGCMALGITGPVLRSTGLPHDLRKAQPYCGYETYDFDVVTDDQCDSYGRYLIRVKEMHQSIRIVEQCVQRLERSVGAPVMITDKKLAWPADLKVGPDGLGNSPEHIAKIMGHSMEGLIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAAMCEGGMVADAITAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

441 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.358 kDa

MSTTTESTHDGAGETLVVAGGQDWDKVVEAARSADPGERIVVNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDQIPERVNVIRVMMMELNRISSHLVALATGGMELGAMTPMFVGFRGREIVLTLFESITGLRMNSAYIRPGGVAQDLPPNAKTEIAQALDQLRQPLREMGDLLNENAIWKARTQDIGYLDLTGCMALGITGPILRATGLPHDLRKSEPYCGYENYEFDVITADTCDAYGRYMIRVKEMWESIKIVEQCLDKLQPGPIMVENGKIAWPADLKVGPDGLGNSPEHIAKIMGGSMEALIHHFKLVTEGIRVPPGQVYTAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQSVAAMCEGGMVADLITAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

441 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.358 kDa

MSTTTESTHDGAGETLVVAGGQDWDKVVEAARSADPGERIVVNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDQIPERVNVIRVMMMELNRISSHLVALATGGMELGAMTPMFVGFRGREIVLTLFESITGLRMNSAYIRPGGVAQDLPPNAKTEIAQALDQLRQPLREMGDLLNENAIWKARTQDIGYLDLTGCMALGITGPILRATGLPHDLRKSEPYCGYENYEFDVITADTCDAYGRYMIRVKEMWESIKIVEQCLDKLQPGPIMVENGKIAWPADLKVGPDGLGNSPEHIAKIMGGSMEALIHHFKLVTEGIRVPPGQVYTAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQSVAAMCEGGMVADLITAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

440 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.833 kDa

MTTTDPFDVLDPTAPVYTVTGGDWQDIVSDIADRHPDRIVVNMGPQHPSTHGVLRLVLELEGETVTQARVVVGYLHTGIEKNCEYRTYTQAVTFLTRADYLSPLFTETAYCLAVEKLLGITDQIPERANVIRVMMMELNRIASHLVWLATGGMEIGALSAMLYGFREREMILDIFEMITGLRMNHAYIRPGGVIQDLPPGAVEKIREFLDIMPARIDEYHDLLTGQPIWVRRLKGVGYLDLTGAVALGATGPIMRAAGYPWDLRKVAPYCGYETYDFEVPTQTDGDCFARYLVRMDEMRESLKIIEQCLDRLRPGPVMVEDKKIAWPAKLALGPDGMGNSLDHIRHIMATSMEALIHHFKLVTEGFHVPPGQVYVPVESPRGELGVHLVSDGGTKPYRVHLREPSFVNLQTVAAVCEGGMVADVIAAVASIDPVMGGCDR

nuoD

NADH-quinone oxidoreductase subunit D

440 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.164 kDa

MTAIADSAGGAGETVLVAGGQDWQQVVDAARSADPGERIVVNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELGAMTPMFVGFRAREIVLTLFEKITGLRMNSAYIRPGGVAQDLPPNAATEIAEALKQLRQPLREMGELLNENAIWKARTQGVGYLDLTGCMALGITGPILRSTGLPHDLRKSEPYCGYQHYEFDVITDDSCDAYGRYMIRVKEMWESMKIVEQCLDKLRPGPTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGSSMEALIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQSVAAMCEGGMVADLIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

440 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.164 kDa

MTAIADSAGGAGETVLVAGGQDWQQVVDAARSADPGERIVVNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELGAMTPMFVGFRAREIVLTLFEKITGLRMNSAYIRPGGVAQDLPPNAATEIAEALKQLRQPLREMGELLNENAIWKARTQGVGYLDLTGCMALGITGPILRSTGLPHDLRKSEPYCGYQHYEFDVITDDSCDAYGRYMIRVKEMWESMKIVEQCLDKLRPGPTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGSSMEALIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQSVAAMCEGGMVADLIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

440 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.164 kDa

MTAIADSAGGAGETVLVAGGQDWQQVVDAARSADPGERIVVNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELGAMTPMFVGFRAREIVLTLFEKITGLRMNSAYIRPGGVAQDLPPNAATEIAEALKQLRQPLREMGELLNENAIWKARTQGVGYLDLTGCMALGITGPILRSTGLPHDLRKSEPYCGYQHYEFDVITDDSCDAYGRYMIRVKEMWESMKIVEQCLDKLRPGPTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGSSMEALIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQSVAAMCEGGMVADLIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

440 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.164 kDa

MTAIADSAGGAGETVLVAGGQDWQQVVDAARSADPGERIVVNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELGAMTPMFVGFRAREIVLTLFEKITGLRMNSAYIRPGGVAQDLPPNAATEIAEALKQLRQPLREMGELLNENAIWKARTQGVGYLDLTGCMALGITGPILRSTGLPHDLRKSEPYCGYQHYEFDVITDDSCDAYGRYMIRVKEMWESMKIVEQCLDKLRPGPTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGSSMEALIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQSVAAMCEGGMVADLIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

440 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.164 kDa

MTAIADSAGGAGETVLVAGGQDWQQVVDAARSADPGERIVVNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDEIPERVNVIRVLMMELNRISSHLVALATGGMELGAMTPMFVGFRAREIVLTLFEKITGLRMNSAYIRPGGVAQDLPPNAATEIAEALKQLRQPLREMGELLNENAIWKARTQGVGYLDLTGCMALGITGPILRSTGLPHDLRKSEPYCGYQHYEFDVITDDSCDAYGRYMIRVKEMWESMKIVEQCLDKLRPGPTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGSSMEALIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQSVAAMCEGGMVADLIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

438 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.114 kDa

MSEDTVFTVAGQDWDDVVDAVKASSGGGGSEGGEERIVVNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRTWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLDITDEVPERASVIRVMLMELNRISSHLVALATGGMELGAVTAMLFGFRERELVLDVFEMITGLRMNHAYIRPGGLSQDLPEGAVEKVRELLALMPERLRDMENLLNDNRIWKGRTQGIGYLDLTGCMALGITGPMLRATGLPHDLRKSQPYCGYENYEFDVSTDTGCDAYGRYLIRVDEMKESLKIVEQCLDKLRPGPIMAEDKKIAWPADLTLGPDGLGNSPGHVREIMDSSMESLIHHFKLVTEGFRVPPGQVYVAVESPRGELGVHMVSDGGTRPFRVHFRDPSFTNLQSVAATCEGGMVADVIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.445 kDa

MSEFRQATDAFASNPVESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHAYVRAIESLMGIQAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGAMAVMLYAFREREELMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPQYKESRWHKGGALKKRNAGREGTMLDFLEEFTNTFPARVDEYETLLTDNRIWKQRTVDVGIISPDLARAWGMTGPMLRGSGIEWDLRKKQPYAKYDAVDFDIPVGTNGDCYDRYLVRVAEMRESNRIIKQCVKWLKANPGPVMVTNFKVAPPSREGMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLMSDGANKPFRVHLRAPGFAHLSSMDAVVRGYLLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.446 kDa

MSEFRQATDAFASNPVESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHAYVRAIESLMGIEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGAMAVMLYAFREREELMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPQYKESRWHKGGALKKRNAGREGTMLDFLEEFTNTFPARVDEYETLLTDNRIWKQRTVDVGIISPDLARAWGMTGPMLRGSGIEWDLRKKQPYAKYDAVDFDIPVGTNGDCYDRYLVRVAEMRESNRIIKQCVKWLKANPGPVMVTNFKVAPPSREGMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLMSDGANKPFRVHLRAPGFAHLSSMDAVVRGYLLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.41 kDa

MSEYRQATDAFASNPVESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHAYVRAIESLMGIEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGAMAVMLYAFREREELMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPKYKESRWHKGGALTKLNAAREGSMLDFLENFTDTFPSRVDEYETLLTENRIWKQRTVDVGIISPDLARAWGMTGPMLRGSGIEWDLRKKQPYAKYDAVDFDVPVGTNGDCYDRYLVRVAEMRESNRIIKQCVKWLKANPGPVMVTNFKVAPPSREGMKDDMEALIHHFKLFSEGYCVPAGETYCAVEAPKGEFGCYLMSDGANKPFRVHLRAPGFAHLSSMDAVVRGYLLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.41 kDa

MSEYRQATDAFASNPVESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHAYVRAIESLMGIEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGAMAVMLYAFREREELMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPKYKESRWHKGGALTKLNAAREGSMLDFLENFTDTFPSRVDEYETLLTENRIWKQRTVDVGIISPDLARAWGMTGPMLRGSGIEWDLRKKQPYAKYDAVDFDVPVGTNGDCYDRYLVRVAEMRESNRIIKQCVKWLKANPGPVMVTNFKVAPPSREGMKDDMEALIHHFKLFSEGYCVPAGETYCAVEAPKGEFGCYLMSDGANKPFRVHLRAPGFAHLSSMDAVVRGYLLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.41 kDa

MSEYRQATDAFASNPVESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHAYVRAIESLMGIEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGAMAVMLYAFREREELMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPKYKESRWHKGGALTKLNAAREGSMLDFLENFTDTFPSRVDEYETLLTENRIWKQRTVDVGIISPDLARAWGMTGPMLRGSGIEWDLRKKQPYAKYDAVDFDVPVGTNGDCYDRYLVRVAEMRESNRIIKQCVKWLKANPGPVMVTNFKVAPPSREGMKDDMEALIHHFKLFSEGYCVPAGETYCAVEAPKGEFGCYLMSDGANKPFRVHLRAPGFAHLSSMDAVVRGYLLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.431 kDa

MSEFRQATDAFASNPAESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHAYVRAIESLMGIEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGAMAVMLYAFREREELMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPRYKESRWHKGGALKKLNAAREGSMLDFLEDFTNTFPLRVDEYETLLTDNRIWKQRTVDVGIISPDLARAWGMTGPMLRGSGIEWDLRKKQPYAKYDAVDFDIPVGTNGDCYDRYLVRVAEMRESNRIIKQCVKWLKANPGPVMVTNFKVAPPSREGMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLMSDGANKPFRVHLRAPGFAHLSSMDAVVRGYLLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.431 kDa

MSEFRQATDAFASNPAESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHAYVRAIESLMGIEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGAMAVMLYAFREREELMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPRYKESRWHKGGALKKLNAAREGSMLDFLEDFTNTFPLRVDEYETLLTDNRIWKQRTVDVGIISPDLARAWGMTGPMLRGSGIEWDLRKKQPYAKYDAVDFDIPVGTNGDCYDRYLVRVAEMRESNRIIKQCVKWLKANPGPVMVTNFKVAPPSREGMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLMSDGANKPFRVHLRAPGFAHLSSMDAVVRGYLLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.431 kDa

MSEFRQATDAFASNPAESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDYVSMMCNEHAYVRAIESLMGIEAPERAQYIRTMFDEITRIKNHLMWVGSNALDLGAMAVMLYAFREREELMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPRYKESRWHKGGALKKLNAAREGSMLDFLEDFTNTFPLRVDEYETLLTDNRIWKQRTVDVGIISPDLARAWGMTGPMLRGSGIEWDLRKKQPYAKYDAVDFDIPVGTNGDCYDRYLVRVAEMRESNRIIKQCVKWLKANPGPVMVTNFKVAPPSREGMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLMSDGANKPFRVHLRAPGFAHLSSMDAVVRGYLLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.394 kDa

MNQIRQAPAASASNATESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHAYVRAIETLIGIQAPERAQYIRTMFDEITRILNHLMWLGSNALDLGAMAVMLYAFREREELMDVYEAISGARMHAAYYRPGGVYRDLPDTMPKYKESRWHKGKALKRLNAAREGSMLDFLEHFTDTFPQRIDEYETLLTDNRIWKQRTVGVGVIEPDVAKAWGMTGVMLRGSGIAWDLRKKQPYAKYDAVDFDIPLGTCGDCYDRYLCRVAEMRESNRIIKQCVQWLKMNPGQVMVENCKVAPPKRESMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLISDGANKPFRVHLRAPGFAHLSSMDAVVRGYMLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.391 kDa

MNQIRQAPATSASNATESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHAYVRAIETLIGIQAPERAQYIRTMFDEITRILNHLMWLGSNALDLGAMAVMLYAFREREELMDVYEAISGARMHAAYYRPGGVYRDLPDTMPKYKQSRWHKGKALKRLNAAREGSMLDFLEHFADTFPQRIDEYETLLTDNRIWKQRTVGVGVIEPDVAKAWGMTGVMLRGSGVAWDLRKKQPYAKYDAVDFDIPLGTCGDCYDRYLCRVAEMRESNRIIKQCVQWLKVNPGQVMVENFKVAPPKRESMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLISDGANKPFRVHLRAPGFAHLSSMDAVVRGYMLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.405 kDa

MNQIRQAPAASASNATESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHAYVRAIETLIGIQAPERAQYIRTMFDEITRILNHLMWLGSNALDLGAMAVMLYAFREREELMDVYEAISGARMHAAYYRPGGVYRDLPDTMPKYKQSRWHKGKALKRLNAAREGSMLDFLEHFTDTFPQRIDEYETLLTDNRIWKQRTVGVGVIEPDVAKAWGMTGVMLRGSGIAWDLRKKQPYAKYDAVDFDIPLGTCGDCYDRYLCRVAEMRESNRIIKQCVQWLKVNPGQVMVENFKVAPPKRESMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLISDGANKPFRVHLRAPGFAHLSSMDAVVRGYMLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.394 kDa

MNQIRQAPAASASNATESKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHAYVRAIETLIGIQAPERAQYIRTMFDEITRILNHLMWLGSNALDLGAMAVMLYAFREREELMDVYEAISGARMHAAYYRPGGVYRDLPDTMPKYKESRWHKGKALKRLNAAREGSMLDFLEHFTDTFPQRIDEYETLLTDNRIWKQRTVGVGVIEPDVAKAWGMTGVMLRGSGIAWDLRKKQPYAKYDAVDFDIPLGTCGDCYDRYLCRVAEMRESNRIIKQCVQWLKMNPGQVMVENCKVAPPKRESMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLISDGANKPFRVHLRAPGFAHLSSMDAVVRGYMLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.523 kDa

MSHVHQAGEAFASNAAESRQEIRNYTMNFGPQHPAAHGVLRLILEMDGETIMRADPHVGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHAYVRAIETLMGIEAPERAQYIRTMYDEITRILNHLMWLGSNALDLGAMAVMLYAFREREELMDCYEAVSGARMHAAYYRPGGVYRDLPDHMPKYKESRWHKGKALKQLNASREGSLLDFLENFTVEFPKRIDEYETLLTDNRIWKQRTVGIGVVTPELAHQWGMTGVMLRGSGVAWDLRKKRPYAKYDAVDFDIPLGKEGDCYDRYLVRVAEMRESNRIIKQCVAWLKANPGPVMVKNFKVAPPRREDMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLVSDGANKPFRVHLRAPGFAHLSSIDSIVRGHMLADVVAMIGTYDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

434 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.578 kDa

MTTPTETYVDASGGDWDEVVAAAQRSQTDRLVINMGPQHPSTHGVLRLILTLDGETVTEARVGIGYLHTGIEKNMEYRTWTQGTTFVTRMDYLTPLFNETAYCLAVEKLLGITDQVPERANVIRVMMMELNRISSHFVAMATFGMELGATTVMTNGFREREMVLDIFEMVTGLRMNHAYIRPGGVAQDLPPGTVGKVRELLTEMPKRLKDMRKLLDANPIYLARTRDVAYLDVTGCLALGVTGPILRAAGLPWDLRKAKPYCGYENYEFDIPVSDGADVYARYRVRMAEIEQSLKIIEQCLDKLKPGPVMIEDPKIGWPAQLALGPDGMGNAPSHIAHIMGKGGSMEALIHHFKLVTEGFRVPPGQAYAAVESPKGELGCFAVSDGGPRPYRVHFRDPSFTNLQAVAAMCEGGTVADVIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

433 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.982 kDa

MSENHEYLSQGGDWAQIVDEAAERGDETVVVNFGPSHPSTHGVMRLIIELDGESVSDLRVGIGFLHTGIEKNMEFRTWTQGVTFMTRCNYVANFFNELVYCLAVEKLLGITDDVPERARVLRVMITELNRISSHLIAVGTGGLELGASSVAEVGLREREIILEFNQAVTGLRMNNAWIRPGGVATDLPETGLDQLRDLIKRMEKYLPEIGQFCNENPIFKARTQGIGYADLSTCMALGVTGPALRATGLPWDLRKTQPYCDYDTYDFDVATWDTCDCYGRFRIRLEEMDQSVRILKQCLKRLEDTQGDRHMVEDPHIAWPAELALGPDGQGNSNEHIRHIMGESMEALIHHFKIVTEGFRVPAGQVYQAIEGAGGELGCHLVSDGGVRPYRSHLRDPGFVNVQSLPAMCEGGMLSDVVPSLASLDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

432 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.621 kDa

MTAQPEIHLMAGGQDWDEIVTAAGQATDERIVVNMGPQHPSTHGVLRLILEIEGETVTDVRCGIGYLHTGIEKNLEYRTWTQGVTFVTRMDYLSPFFNETAYCLGVEQLLGIADEIPERANVIRVLMMELNRISSHLVALATGGMELGAMTAMFLGFREREMILKVFEAITGLRMNHAYVRPGGLAQDLPDGAEQEVRDLLEILPGRLRDMENLLNENYIWKARTQGVGYLDLTGCMALGITGPVLRATGLAHDLRRAQPYCGYENYDFDVVTHQDCDSYGRYLIRVKEMHESIKIAQQCVDRLRPGPVMVDDKKIAWPADLASGPDGLGNSPKHIAKIMGTSMEGLIHHFKLVTEGVRVPAGQVYVAIESPRGELGVHMVSDGGTRPYRVHFRDPSFTNLQSVAAMCEGAMVADLIAAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

432 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.503 kDa

MTDTETVLVAGGQDWNEIVEAARGADPGERIVVNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDEIPERVNVIRVMMMELNRISSHLVALATGGMELGAMTPMFVGFRAREIILSLFESITGLRMNSAYIRPGGVAQDLPPDGPTEIAKAIADLRQPLREMGDLLNENAIWKARTQDVGYLDLAGCMALGITGPILRSTGLPHDLRKSEPYCGYENYEFDVITADGCDAYGRYMIRVKEMWESIKIVEQCLDRLRPGPTMIEDRKLAWPADLKVGPDGMGNSPEHIAKIMGSSMEALIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAAMSEGGMVADLITAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

432 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.572 kDa

MTDTETVLVAGGQDWNEIVEAARGADPGERIVVNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGITDEIPERVNVIRVMMMELNRISSHLVALAAGGMELGAMTPMFVGFRAREIILSLFESITGLRMNSAYIRPGGVAQDLPPDRPTEIAKAIADLRQPLREMGDLLNENAIWKARTQDVGYLDLAGCMALGITGPILRSTGLPHDLRKSEPYCGYENYEFDVITADGCDAYGRYMIRVKEMWESIKIVEQCLDRLRPGPTMIEDRKLAWPADLKVGPDGMGNSPEHIAKIMGSSMEALIHHFKLVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQAVAAMSEGGMVADLITAVASIDPVMGGVDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.594 kDa

MANKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQAYCLAVEKLAGIDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGAMTAILYAFRDREELMDLYEAVSGARMHAAYFRPGGVYRDLPGFMPKYESSKFRNAKVLKQLNESREGTMLDFIDAFCERFPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFTGVMLRGSGVEWDVRKTQPYEVYDKMDFDIPVGVNGDCYDRYLCRMEEMRQSVRIIKQCADWLRVNPGPVITANHKFAPPKRTEMKTGMEDLIHHFKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDGANKPYRLKIRAPGFAHLQGMDEMAKGHMLADVVAIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.594 kDa

MANKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQAYCLAVEKLAGIDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGAMTAILYAFRDREELMDLYEAVSGARMHAAYFRPGGVYRDLPGFMPKYESSKFRNAKVLKQLNESREGTMLDFIDAFCERFPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFTGVMLRGSGVEWDVRKTQPYEVYDKMDFDIPVGVNGDCYDRYLCRMEEMRQSVRIIKQCADWLRVNPGPVITANHKFAPPKRTEMKTGMEDLIHHFKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDGANKPYRLKIRAPGFAHLQGMDEMAKGHMLADVVAIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.772 kDa

MANKLRNYTINFGPQHPAAHGVLRMILELEGETIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQAYCLAVEKLAGIDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGAMTAILYAFRDREELMDLYEAVSGARMHAAYFRPGGVYRDLPDFMPKYESSKFRNAKVLKQLNESREGTMLDFIDAFCERFPKNIDTLETLLTDNRIWKQRTVGIGVVTPERAMQKGFTGVMLRGSGVEWDVRKKQPYEMYDKMDFDIPVGVNGDCYDRYLCRMEEMRQSVRIIKQCSEWLRVNPGPVITTNHKFAPPKRTEMKTGMEDLIHHFKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDGANKPYRLKIRAPGFAHLQGMDEMAKGHMLADVVAIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.712 kDa

MANKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQAYCLAVEKLAGIDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGAMTAILYAFRDREELMDLYEAVSGARMHAAYFRPGGVYRDLPDFMPKYESSKFRNAKVLKQLNESREGTMLDFIDAFCERFPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFTGVMLRGSGVEWDVRKTQPYEVYDKMDFDIPVGVNGDCYDRYLCRMEEMRQSVRIIKQCSEWLRVNPGPVITTNHKFAPPKRTEMKTGMEDLIHHFKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDGANKPYRLKIRAPGFAHLQGMDEMAKGHMLADVVAIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.71 kDa

MANKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQAYCLAVEKLVGIDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGAMTAILYAFRDREELMDLYEAVSGARMHAAYFRPGGVYRDLPDFMPKYEGSKFRNAKVLKQLNESREGTMLDFIDAFCERFPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFTGVMLRGSGVEWDVRKTQPYEVYDKMDFDIPVGVNGDCYDRYLCRMEEMRQSVRIIKQCSEWLRVNPGPVITTNHKFAPPKRTEMKTGMEDLIHHFKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDGANKPYRLKIRAPGFAHLQGMDEMAKGHMLADVVAIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.699 kDa

MANKLRNYTINFGPQHPAAHGVLRMILELEGETIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDYVSMMVNEQAYCLAVEKLAGIDVPIRAQYIRVMFAEVTRILNHLMGIGSHAFDIGAMTAILYAFRDREELMDLYEAVSGARMHAAYFRPGGVYRDLPDFMPKYESSKFRNAKVLKQLNESREGTMLDFIDAFCERFPKNIDTLETLLTDNRIWKQRTVGIGVVSPERAMQKGFTGVMLRGSGVEWDVRKTQPYEVYDKMDFDIPVGVNGDCYDRYLCRMEEMRQSVRIIKQCSEWLRVNPGPVITTNHKFAPPKRTEMKTGMEDLIHHFKLFTEGMHVPEGETYTAVEHPKGEFGVYIISDGANKPYRLKIRAPGFAHLQGMDEMAKGHMLADVVAIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.576 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAEHKTFIQALPYMDRLDYVSMMCNEHAYVMAIEKMLGVEAPLRAQYIRVMFDEITRILNHLMSLGSHALDVGAMAVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPDTMAQYGETSKYRSDKELRAMNDARSGSLLDFIEDFTNRFPACVDEYETLLTDNRIWKQRLVGIGVVDPDRAKALGFTGPMLRGSGVAWDLRKTQPYEVYDLMDFDVPVGVNGDCYDRYLVRVAELRESNRIIRQCVEWLRNNPGPVMIENHKIAPPKREAMKSNMEELIHHFKLFTEGFHVPPGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLQSLDEMSRGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.428 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFIQALPYMDRLDYVSMMCNEHAYVMAIEKLLGIEAPLRAQYIRVMFDEITRVLNHLMSLGSHALDVGAMAVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPDTMPQYGDSSKYRGEKEVRAMNDARSGSLLDFIEDFTNRFPGCVDEYETLLTDNRIWKQRLVGIGVVDPDRAKALGFTGPMLRGSGVAWDLRKTQPYEVYDLMDFDVPVGVNGDCYDRYLVRVAEMRESNRIIRQCVEWLRNNPGPVMIENHKIAPPSRTAMKSNMEELIHHFKLFSEGFHVPPGEAYAAVEHPKGEFGIYLVADGANKPYRLKIRAPGFAHLQSLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.428 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFIQALPYMDRLDYVSMMCNEHAYVMAIEKLLGIEAPLRAQYIRVMFDEITRVLNHLMSLGSHALDVGAMAVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPDTMPQYGDSSKYRGEKEVRAMNDARSGSLLDFIEDFTNRFPGCVDEYETLLTDNRIWKQRLVGIGVVDPDRAKALGFTGPMLRGSGVAWDLRKTQPYEVYDLMDFDVPVGVNGDCYDRYLVRVAEMRESNRIIRQCVEWLRNNPGPVMIENHKIAPPSRTAMKSNMEELIHHFKLFSEGFHVPPGEAYAAVEHPKGEFGIYLVADGANKPYRLKIRAPGFAHLQSLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.624 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTYIQALPYMDRLDYVSMMCNEHAYVMAIEKLLGIEPPLRAQYIRVMFDEITRLLNHLMSLGSHALDVGAMAVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPDTMPQYGESSKYRGEKDLRIMNDARSGSLLDFIEDFTNRFPACVDEYETLLTDNRIWKQRLVGIGVVDPERAKALGFTGPMLRGSGVAWDLRKMQPYEVYDLVDFDVPVGVNGDCYDRYLVRIAEMRESNRIIRQCVEWLRNNPGPVMVENHKVAPPKRTGMKTNMEDLIHHFKLFTEGFHVPPGEAFASIEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLQSLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.458 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFIQALPYMDRLDYVSMMCNEHAYVMAIEKLLGIEAPLRAQYIRVMFDEITRVLNHLMSLGSHALDVGAMAVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPDTMPQYGDSSKYRGEKEVRAMNDARSGSLLDFIEDFTNRFPSCVDEYETLLTDNRIWKQRLVGIGVVDPDRAKALGFTGPMLRGSGVAWDLRKTQPYEVYDLMDFDVPVGVNGDCYDRYLVRVAEMRESNRIIRQCVEWLRNNPGPVMIENHKIAPPSRTAMKSNMEELIHHFKLFSEGFHVPPGEAYAAVEHPKGEFGIYLVADGANKPYRLKIRAPGFAHLQSLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

418 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.606 kDa

MAEGLTREVRMEVPDTAELLRRSEDISGAPEGERLILNMGPSHPSTHGVFQLLLELDGEVITKAIPEVGYLHRGDEKIAENMQYNQFVPYTDRLDYLAPLANNVVYACAVEKLLGWEIPARAQVIRVICSEMARISSHLMGLGAYAMDCGAVSVFLYTFTEREKIYLLIEELTGARFTTSYTRIGGLTRDLPPGWTEKLKDFIKQFLPKVDEIEGLLTKNKIFVDRTQDIGIISKEDAIDYGLTGPNLRGSGVDHDLRKKNPYLGYEKYDFEVPLGSVGDCFDRYMVRIEEMRQSCRILDQALADIPPGPIAVDEPRGYLPKKSAVLTKMEELIQHFIVVTQGVDVPPGEVYFGGENPKGELGFYIVSKGGGVPYRLKIRSPSFVNLSILPKILPGHLLSDVVAILGSLDFVMGECDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.444 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNEKALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSIRIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.444 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNEKALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSIRIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.486 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDYVSMMVNEHGYVLAIERLLGIDVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNEKALARMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSIRIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.414 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNEKALAKMNEARSGSVLDFIDDFFARFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSIRIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.413 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIAVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNEKALAKMNEARSGSVLDFIDDFFTRFPKCIDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSVRIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.507 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.507 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.507 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.507 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.507 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.507 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.507 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.507 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.451 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRIDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRENPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.5 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIERLLGIDVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQFKASKIRNEKALAKMNEARSGSVLDFIDDFFTRFPKCIDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSVRIAKQCIEWLRKNQGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.943 kDa

MREFKSYTVNFGPQHPAAHGVLRMVLEMEGETVRRADPHIGLLHRATEKLAESKPYNQSIGYMDRLDYVSMLCNEHAYVMAIEKLLGIEAPIRAQYIRVMFDEITRILNHLMWLGAHGLDVGAMTAFLYCFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPESMPKYEPSKFRSKKELELMNAARQGTMLDFIEDFTERFPGCVDEYETLLTENRIWRQRLVDVGVVSPERALQLGFSGPMLRGSGIEWDLRKKQPYDVYDRVEFDIPVGTNGDCYDRYLVRIEEMRQSNRIIKQCVDWLRHNPGPVMLEDHKVAPPSREEMKDDMESLIHHFKLFTEGYTTPPGEVYAAVEAPKGEFGCYMISDGANKPYRVKLRAPGFAHLSAMDEMARGHMLADVVAIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.783 kDa

MAEIRNYTINFGPQHPSAHGVLRLVLELDGEVVVRADPHIGLLHRGTEKLAETRTWVQSVPYMDRLDYVSMMCNEHAYCLAIERLLGLEVPIRAQYIRVMFDEITRILNHLLGIGTHALDIGAMTMVLYTFREREDLMDAYEAVSGARMHAAYYRPGGVYRDLPDRMPQYVVNKFKNANTVRELNENRQGSLLDFLEDFTERFNGYCDDYETLLTDNRIWKQRTVGIGVVTPEQAKAWGFTGPMLRGSGVAWDLRKKQPYEVYDRMDFDIPVGKNGDCYDRYLCRMEEMRQSNRIVKQCIDWLRKNPGPVIADNYKVAPPPRERMKGNMEELIHHFKLFTEGMHVPSGEVYAAIEHPKGEFGVYAVSDGANKPYRLKLRAPGFAHLAAMDEIARGHMIADVVAIIGTMDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.815 kDa

MAEIRNYTINFGPQHPSAHGVLRLVLELDGEVVERADPHIGLLHRGTEKLAETRTWVQSVPYMDRLDYVSMMCNEHAYCMAIERLLGVEVPLRAQYIRVMFDEITRILNHLLNIGTHALDIGAMTMVLYTFREREDLMDAYEAVSGARMHAAYYRPGGVYRDLPDRMPQYQPNKFKNANVVKDLNAARQGSLLDFLDDFTQRFPRYCDEYETLLTDNRIWKQRTVGIGVVTPEQALAWGFSGPMIRGSGIAWDLRKKQPYEVYDKVDFDIPVGKNGDCYDRYLCRMEEMRQSNRIIRQCIDWLRKNPGPVITDNHKVAPPSREQMKSNMEELIHHFKLFTEGMHVPKGEAYAAVEHPKGEFGVYAVSDGANKPYRLKLRAPGFAHLAAMDEISRGHMIADVVAIIGTMDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.503 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIDVPIRAKYIRVLFDEVTRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNTKALSKLNENRQGSLLDFIEDFFNRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGAMLRGSGIEWDLRKKQPYEVYDQMDFDIPVGVNGDCYDRYLVRVEEMRQSTRIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKSNMEELIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIADAVTIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.566 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETKTFIQSVPYMDRLDYVSMMVNEHGYVMAIEKLLGIEVPVRAQYIRVMFDEVTRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNAKALSKMNENRQGSLLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALNLGMTGAMLRGSGIEWDLRKKQPYEVYDKLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIVKQCIEWLRKNPGPVMIDNHKVAPPSRVGMKSNMEELIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLISDGANKPYRLKIRAPGYAHLSTLDEMARGHMIADAVTIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.552 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETKTFIQSVPYMDRLDYVSMMVNEHGYVMAIEKLLGIDVPVRAQYIRVMFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNAKALSKMNENRQGSLLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALNLGMTGAMLRGSGIEWDLRKKQPYEVYDKLDFDIPVGVNGDCYDRYLVRVEEMRQSTRIVKQCVEWLRKNPGPVMIDNHKVAPPSRVGMKSNMEELIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLISDGANKPYRLKIRAPGYAHLSTLDEMARGHMIADAVTIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.816 kDa

MTKIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETRTWIQNVPYMDRLDYVSMMSNEHAYVLAIEKLLQVDVPLRAQYIRVMFDELTRLLNHLLWIGCHGLDVGAMAVFLYAFRDREDIFDMYEAVSGARMHAAYYRPGGVYRDLPDQMAQYSKSKIRSASAIKRLNENRSGTLLDFIDQFTNGFDANVDEYCNLLTDNRIWKQRLVNIGIVTPERALQLGFTGPMLRGSGIEWDLRKKQPYEVYDRLDFDIPVGVNGDSYDRYLVRMEEMRQSNRIIKQCVAWLKANSGPVMSDNHKVSPPKRVDMKTNMEELIHHFKLFTEGMHVPNGEAYSAVEHPKGEFGIYLISDGANKPYRMKIRAPGFVHLSAMDEMSRGHMLADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.483 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDYVSMMSNEHAYCLAIEKLLGVDVPIRAQYIRVMFSEITRLLNHLMWLGAHGLDCGAMNMLIYCFREREVLFDMYEAVSGARMHAAYFRPGGVYRDLPESMSQYKVNKIRNAKAIDALNENRQGSLLDFIDDFVTKFPKLVDEYETLLTDNRIWKQRTVGVGVVSPERALNLGFTGPMLRGSGFAWDLRKQQPYEVYAQMDFDIPVGKTGDCYDRYLVRVAEMRQSNRIIKQCVDWLRVNSGPVITSNHKVAPPNRESMKSNMEELIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYIVSDGANKPYRLKIRPPGFSHLAAMDEMSRGHMIADAVAVIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.806 kDa

MAQIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAKTRTWIQNIPYMDRLDYVSMMSNEHAYVMAIEKLLQVDVPLRAQYIRVMYDELTRLLNHLLWIGCHGLDVGAMAVFLYAFRDREDIFDMYEAVSGARMHAAYYRPGGVYRDLPDQMAQYDKSKIRSASAVKRLNENRSGTLLDFIEQFANGFDANVDEYCNLLTDNRIWKQRLVNIGIVTPKRALQLGFTGPMLRGSGIEWDLRKKQPYEVYDRLDFDIPVGVNGDSYDRYLVRMEEMRQSNHIIKQCVAWLKANPGPVMSTNHKVSPPKRVDMKTNMEELIHHFKLFTEGIHVPDGEAYSAVEHPKGEFGIYLISDGANKPYRMKIRAPGFVHLSSMDEMSRGHMLADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.534 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDYVSMMSNEQAYCLAIEKLLGVDVPIRAQYIRVMYAEITRLLNHLLWLGAHGFDCGAMNILIYCFREREALFDMYEAVSGARMHAAYFRPGGVYRDLPDTMPQYRVSKIKNAKAIAALNENRQGSLLDFIDDFVAKFPRLVDEYETLLTDNRIWKQRTVGVGVVSPERALNLGFTGPMLRGSGFAWDLRKQQPYDVYDRMDFDIPVGKTGDCYDRYLVRIEEMRQSNRIIKQCIDWLRVNPGPVITSNHKVAAPDRESMKTNMEELIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYIVSDGANKPYRLKIRPPGFPHLAAMDEMSRGHMIADAVAVIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.775 kDa

MADIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTWIQSVPYMDRLDYVSMMVNEHAYVMAIERLLGLEVPLRAQYIRVMFDEITRIMNHLMWIGSHALDVGAMAVFLYAFREREDLFDMYEAVSGARMHAAYYRPGGVYRDLPDTMPQYKASKVRNEKALAALNQTRSGSLLDFIEDFTNRFPKYVDEYETLLTDNRIWKQRLVGIGVVSPERALNKGFSGAMLRGSGIEWDVRKKQPYEVYDRIDFDIPVGVNGDCYDRYLVRVEEMRQSNRIIRQCIEWLRKNPGPVITDNHKVAPPSRVDMKTNMEELIHHFKLFTEGMHVPEGEAYAAVEHPKGEFGIYAISDGANKPYRLKIRAPGFVHLAALDEMAKGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.567 kDa

MAEIKNYSLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAEHKTFIQSLPYMDRLDYVSMMCNEHAYCLAIEKLLGIDVPLRAQYIRVMFSEITRLLNHLMWLGSHGNDCGSSTILIYTFREREDLFDMYEAVSGARMHAAYFRPGGVYRDLPDSMPQYQASKVRNAKAIEVLNQNRQGSLLDFIDDFTQRFPKCVDEYETLLTDNRIWKQRTVDIGIVTPERALNLGMTGPMLRGSGIAWDLRKKQPYDAYDRVEFDIPVGKTGDCYDRYLVRVQEMRQSNRIIKQCVDWLKANPGPVITDNHKVAPPSRESMKSNMEELIHHFKLFTEGFRVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLATLDEMARGHMIADAVAIIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.504 kDa

MPEINNFTMNFGPQHPSAHGVLRLVLELDGEVIERADPHIGLLHRATEKLAENKTYLQNLPYMDRLDYVSMLCNEHAYCLAVEKLLGVEVPVRAQYIRTLFDEITRILNHLLWLGAYALDVGAMSVFLYCFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPAQMPQYQPSPYRDARRLQELNANRQGSMLDFIEDFARRFPTYVDEYETLLTDNRIWKQRTVGIGVVGPERAIQLGFTGPMLRSSGVAWDLRRTQPYAAYADLDFDIPVGKTGDCYDRYLVRVAEMRQSNRIIVQCVDWLRKNPGPVITDDFKIAAPSREEMKTSMEALIHHFKLFSEGMAVPAGEVYAAVEAPKGEFGIYMISDGANKPYRMKIRAPGFPHLAAMDEMARGHMIADVVAILSTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.436 kDa

MAEIKNYSLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAEHKTYIQSLPYMDRLDYVSMMCNEQAYCLAIEKMLGIEVPLRAKYIRTMFGEITRLLNHLMWLGSHGNDCGSSTILIYTFREREDLFDMYEAVSGARMHAAYFRPGGVYRDLPDSMAQYKVSKIKNAKAIEELNRNRQGSLLDFIDDFTQRFPKCVDEYETLLTDNRIWKQRTVGIGVVPAERALNLGMTGPMLRGSGIAWDLRKKQPYDAYDRVDFDVPVGVTGDSYDRYLVRVQEMRESNRIIKQCVDWLRANPGPVITDNHKIAPPSREAMKSNMEELIHHFKLFTEGFRVPAGEAYAAVEHPKGEFGIYMVSDGANKPYRLKIRAPGFAHLATLDEMARGHMLADAVAIIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.935 kDa

MADIRNYTMNFGPQHPAAHGVLRLVMELDGEVIRRADPHIGLLHRATEKLAENKTYIQSVPYMDRLDYVSMMVNEHAYVMAIEKLLQIDVPIRAQYIRVMFDEITRILNHLLWLGAHALDVGAMTVFLYTFREREDLMDCYEAVSGARLHAAYYRPGGVYRDLPDSMPQYRSSAIHDEKTTTARNENRQGSLLDFIEDFTHRFPGYVDDYETLLTDNRIWKQRLVDIGVVSPDRAKALGFSGPMLRGSGVAWDLRKKQPYEVYDQVDFDIPVGVNGDCYDRYLVRIEEMRQSNYIIKQCIDWMRKNPGPVITSNFKVAPPPRLSMKQNMEEMIHHFKLFTEGMHVPRGEVYAAVEHPKGEFGIYIISDGANMPYRLKIRAPGFAHLAAMDEMARGHMIADLVAIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.887 kDa

MAEIRNYTMNFGPQHPAAHGVLRLVMELDGEVIRRADPHIGLLHRATEKLAENKTYVQSVPYMDRLDYVSMMVNEHAYVMAIEKLLQIEVPIRAQYIRVMFDEITRILNHLLWLGAHALDVGAMTVFLYAFREREDLMDCYEAVSGARLHAAYYRPGGVYRDLPDNMPQYQPSAIHDEKATRARNENRQGSLLDFIEDFTRRFPGYIDDYEALLTDNRIWKQRLVDIGVVSPDRAKALGFTGPMLRGSGVEWDLRKKQPYEVYDQVDFDIPVGANGDCYDRYLVRIEEMRQSNHIIKQCVEWLRKNPGPVITDNHKVAPPSRLAMKQNMEEMIHHFKLFTEGMHVPRGEAYAAVEHPKGEFGIYIVSDGANKPYRLKIRAPGFAHLAALDEMTKGHMIADLVAIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.987 kDa

MAEIRNYTMNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEYKTYIQSVPYMDRLDYVSMMANEHAYVMAIEKLLQLEVPIRAQYIRVMFDEITRILNHLLWLGAHALDVGAMTVFLYAFRDREDLMDAYESVSGARMHAAYYRPGGVYRDLPDSMPQYKASKIHDEKTTKARNENRQGSLLDFIEDFTNRFPTYVDEYETLLTDNRIWKQRLVGIGTVSPERAMALGFTGPMLRGSGVEWDLRKKQPYEVYDQLDFDIPVGVNGDCYDRYLVRIEEFRQSNRIIRQCVDWLRKNPGPVITDNHKVAPPSRVNMKQNMEELIHHFKLFTEGFHVPPGETYAAVEHPKGEFGIYLISDGANMPYRMKIRAPGFAHLAALDEMSRGHMIADVVAIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.588 kDa

MAEIRNFTLNFGPQHPAAHGVLRLVLEMDGEIIQRADPHVGLLHRATEKLAESKPFNQSIGYMDRLDYVSMMCNEHGYVKAIETLLGIEPPLRAQYIRTMFDEITRILNHLMWLGAHGLDIGAMTVFLYCFREREDLMDCYEAVSGARMHATYYRPGGVYRDLPETMPGYQPSKWHNEKEVAIINRNREGSLLDFIEDFTARFPTCVDEYETLLTDNRIWKQRTVGIGVVTPERALQLGFTGPMLRGSGVEWDLRKKQPYAAYDQIDFDIPVGVNGDCYDRYLVRIEEMRQSNQIIKQCVDWLRKNPGPVIVNNYKVAAPPREKMKNDMEVLIHHFKLFTEGYCVPEGEAYAAVEAPKGEFGVYLISDGANKPYRLKVRAPGFAHLAAMDEMVQGHMLADVVAIIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.485 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIERLLGIDVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNEKALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSIRIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.444 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNEKALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSIRIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.401 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEITRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDAMPQYKASKIRNEKALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQRLVGIGVVSPERALQMGLTGPMLRGSGIAWDLRKKQPYEVYDRMDFDVPVGVNGDCYDRYLVRVEEMRQSILIAKQCIEWLRKNPGPVMTDNHKVAPPSRVGMKTNMEDLIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLASLDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.339 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETKTYIQALPYMDRLDYMSMMCNESAYCLAVEKMLGLEVPIRAKYIRVMFAEITRLLNHLLCVGAGALDCGAMTVMLYAFREREDLLDMYEAVSGARMHAAYFRPGGVYRDLPDTMARHQPNKIRSAKSTEKLNRNRDGSLLDFIDDFTQRFPTYLGEYHTLLTDNRIWKQRTVGIGVVTAERALNLGFSGPMLRGSGVAWDLRKKQPYEIYDRLDFDIPVGKTGDCYDRYLVRMEEMKQSNRIIKQCVDWLRVNPGPVITDNHKIAPPNRESMKSNMEELIHHFKLFSEGFSVPEGEAYATIEHPKGEFGIYMVSDGANKPYRMKIRPPAFVHLAALGEMGRGHMIGDAVAIIGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.336 kDa

MAEIRNYTLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRGTEKLAESKTFIQSLPYMDRLDYVSMMCNEHAYCLAIEKMMGIEVPERAQYIRVMFAEITRILNHLLWIGAHALDIGAMTMFLYAFREREDLMDCYEAVSGARMHAAYFRPGGVYRDLPDSMPQYTVSKIKNAKELARLNEGRKGSMLDFIEDFTKRFPTYVDEYETLLTDNRIWKQRTVGIGVVTPERALNLGMTGPMLRGSGIAWDLRKTQPYDVYDKMDFDVPVGVGGDCYDRYLVRVEEMRQSNRIIQQCVAWLRANPGPVITDNHKVAPPSREGMKSNMEDLIHHFKLFTEGMHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLAALDEMATGHMIADVVAIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.129 kDa

MAEVRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDYVSMMANEHGYVLAIEKLLGIEPPIRAKYIRTMFDEITRILNHLLWLGAHALDVGAMTVFLYCFREREDLMDCYEAVSGARMHATYYRPGGVYRDLPDSMPKYKPSRWHNEKAVKKMNEAREGSLLDFIWDFTARFPNLIDEYESLLTDNRIWKQRTVGIGVVSAERALQLGFTGPMLRASGVEWDLRKKQPYAAYDRVDFDIPIGREGDCYDRYLVRIEEMRQSNRIIRQCVEWLRKNPGPVMIDDYKIVPPQREVMKRDMEALIHHFKLFTEGYIVPEGEAYAAVEQPKGEFGVYIVSDGANKPYRVKVRAASYPHLAAMNEMCRGHMIADLVAIISSIDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.129 kDa

MAEVRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDYVSMMANEHGYVLAIEKLLGIEPPIRAKYIRTMFDEITRILNHLLWLGAHALDVGAMTVFLYCFREREDLMDCYEAVSGARMHATYYRPGGVYRDLPDSMPKYKPSRWHNEKAVKKMNEAREGSLLDFIWDFTARFPNLIDEYESLLTDNRIWKQRTVGIGVVSAERALQLGFTGPMLRASGVEWDLRKKQPYAAYDRVDFDIPIGREGDCYDRYLVRIEEMRQSNRIIRQCVEWLRKNPGPVMIDDYKIVPPQREVMKRDMEALIHHFKLFTEGYIVPEGEAYAAVEQPKGEFGVYIVSDGANKPYRVKVRAASYPHLAAMNEMCRGHMIADLVAIISSIDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.111 kDa

MAEVRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDYVSMMANEHGYVLAIEKLLGIEPPIRAKYIRTMFDEITRILNHLLWLGAHALDVGAMTVFLYCFREREDLMDCYEAVSGARMHATYYRPGGVYRDLPDSMPKYKPSRWHNEKAVKKMNEAREGSLLDFIWDFTARFPNLIDEYESLLTDNRIWKQRTVGIGVVSAERALQLGFTGPMLRASGVEWDLRKKQPYAAYDRVDFDIPIGREGDCYDRYLVRIEEMRQSNRIIRQCVEWLRKNPGPVIIDDYKIVPPQREVMKRDMEALIHHFKLFTEGYIVPEGEAYAAVEQPKGEFGVYIVSDGANKPYRVKVRAASYPHLAAMNEMCRGHMIADLVAIISSIDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.96 kDa

MAEIRNYTMNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFLQALPYMDRLDYVSMMVNEHAYVMAIEKLLGIEVPERAQYIRVMFDEITRVLNHLLWLGAHALDVGAMTVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPDRMPQYQAQHTRNESTMKSMNANRQGSLLDFIEDFTTRFPAYVDEYETLLTDNRIWKQRTVGIGVVAPERALALGFTGPMLRGSGVEWDLRKKQPYEVYERMDFDIPVGTNGDCYDRYLVRIEEMRQSNRIIRQCVDWLRKNPGPIMVDNHKVSPPPRVDMKQNMEELIHHFKLFTEGMHVPAGEAYAAVEHPKGEFGIYLVSDGANKPYRMKIRAPGFAHLEALDEMSRGHMIADVVAIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.097 kDa

MAEIKNYCLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAEHKTYIQSLPYMDRLDYVSMMCNEHAYCLALEKLLGLPVPLRAQYIRVLFAEITRLLNHLMWLGSHANDCGSSTMLMYTFREREDLFDMYEAVSGARMHAAYFRPGGVYRDLPDSMPRYQASKIRNARALAALNQNRQGSLLDFIADFAQRFPGCVDEYETLLTDNRIWKQRTVGIGVVSPQRALNLGMTGPMLRGSGIAWDLRKTQPYDVYEHMDFDVPVGKTGDCYDRYLVRVQEMREANRIIGQCVAWLRANPGPVITDNHKVAAPGRAAMKSNMEELIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLATLDEMARGHMIADAVAIIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.129 kDa

MSEIRNYTLNFGPQHPAAHGVLRLILEIDGEVIERADPHIGLLHRGTEKLVESKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEAMLNLKVPKRAQYIRVMFDEITRILNHLMWLGTHGLDVGAMSIFLYAFREREKLIDCYEAVSGSRMHATYYRPGGVYRDLPDKMPQYLASDFRTSKELETMNENRQGSLLDFIADFVKEFPKSIKQYDDLLTDNRIWKQRLVNIGVVSANRAKQLGFTGPMLRGSGVEWDLRKNQPYAVYDQLKFDIPVGMTGDSYDRYLVRMEEMRQSNYIIKQCVKWLRENPGAVMSDDHKVSQPKRTNMKNDMESLIHHFKLFTEGYCLPEGEVYRAVEHPKGEFGVYLISDGANKPYRVKIRAPGFSHLAAMNEMTRGHMLSDVVTIIGTQDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.193 kDa

MIELKNYTLNFGPQHPAAHGVLRLVLELEGETIVRADPHIGLLHRATEKLAETKPYIQSIGYMDRLDYVSMMCNEHAYVMAIEKLLGIEPPLRAKYIRTMFDEVTRILNHLLWLGATALDIGAMTVFLYCFREREDLFDCYEAVSGARMHATYYRPGGVARDLPDTMPQYKPSRWHNEREIEKKNHNRQGSLLDFLWAFTERFPRCVDEYETLLTDNRIWKQRTVDIGIVSPENALQWGFTGPMLRGSGIAWDLRKKQSYAAYDRVDFDIPVGKTGDCYDRYLVRVEELRQSNRIIRQCIEWLRKHPGPVKVDDYKVTPPRRVVMKHDMEALIHHFKLFTEGFCLPRGEVYSSVEAPKGEFGIYMVSDGANKPYRLKIRAPGFAHLSSFDDMVRGHMLADGVAILASQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.193 kDa

MIELKNYTLNFGPQHPAAHGVLRLVLELEGETIVRADPHIGLLHRATEKLAETKPYIQSIGYMDRLDYVSMMCNEHAYVMAIEKLLGIEPPLRAKYIRTMFDEVTRILNHLLWLGATALDIGAMTVFLYCFREREDLFDCYEAVSGARMHATYYRPGGVARDLPDTMPQYKPSRWHNEREIEKKNHNRQGSLLDFLWAFTERFPRCVDEYETLLTDNRIWKQRTVDIGIVSPENALQWGFTGPMLRGSGIAWDLRKKQSYAAYDRVDFDIPVGKTGDCYDRYLVRVEELRQSNRIIRQCIEWLRKHPGPVKVDDYKVTPPRRVVMKHDMEALIHHFKLFTEGFCLPRGEVYSSVEAPKGEFGIYMVSDGANKPYRLKIRAPGFAHLSSFDDMVRGHMLADGVAILASQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.177 kDa

MIELKNYTLNFGPQHPAAHGVLRLVLELEGETIVRADPHIGLLHRATEKLAETKPYIQSIGYMDRLDYVSMMCNEHAYVMAIEKLLGIEPPLRAKYIRTMFDEVTRILNHLLWLGATALDIGAMTVFLYCFREREDLFDCYEAVSGARMHATYYRPGGVARDLPDTMPQYKPSRWHSEREIEKKNHNRQGSLLDFLWDFTERFPHCVDEYETLLTDNRIWKQRTVDIGVVSPENALQWGFTGPMLRGSGIAWDLRKKQSYAAYDRVEFDIPVGKTGDCYDRYLVRVEELRQSNRIIRQCIEWLRKHPGPVKVDDYKVSPPRRVVMKHDMEALIHHFKLFTEGFCLPRGEVYSSVEAPKGEFGIYMVSDGANKPYRLKIRAPGFAHLSSFDDMVRGHMLADGVAILASQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.177 kDa

MIELKNYTLNFGPQHPAAHGVLRLVLELEGETIVRADPHIGLLHRATEKLAETKPYIQSIGYMDRLDYVSMMCNEHAYVMAIEKLLGIEPPLRAKYIRTMFDEVTRILNHLLWLGATALDIGAMTVFLYCFREREDLFDCYEAVSGARMHATYYRPGGVARDLPDTMPQYKPSRWHSEREIEKKNHNRQGSLLDFLWDFTERFPHCVDEYETLLTDNRIWKQRTVDIGVVSPENALQWGFTGPMLRGSGIAWDLRKKQSYAAYDRVEFDIPVGKTGDCYDRYLVRVEELRQSNRIIRQCIEWLRKHPGPVKVDDYKVSPPRRVVMKHDMEALIHHFKLFTEGFCLPRGEVYSSVEAPKGEFGIYMVSDGANKPYRLKIRAPGFAHLSSFDDMVRGHMLADGVAILASQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.52 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAESKTFIQSLPYMDRLDYVSMMCNEHAYCLAIEKLMGIQVPERAQYIRVMFSEITRLLNHLLWLGCHGMDCGAMNMLIYCFREREDLFDMYEAVSGARMHAAYFRPGGVYRDLPDVMPQYKVSKIRNAKAMARLNENRQGSLLDFIDDFTKRFPTLVDEYETLLTDNRIWKQRTVGIGVLTPERALNLGLTGAMIRGSGIAWDLRKTQPYDVYDRMDFDIPVGVNGDTYDRYLVRVEEMRQSNRIIEQCSAWLRANPGPVITDNHKVAPPSRVEMKTSMEELIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYAISDGANKPYRLKIRAPGFAHLAALDEMSRGHMIADAVAIIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.877 kDa

MAEIRNYTMNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAENRTYLQSVPYMDRLDYVSMMVNEHAYVMAIEKLLGLEVPLRAQYIRVMFDEITRILNHLLWLGAHALDVGAMTVFLYAFREREDLFDCYEAVSGARMHAAYYRPGGVYRDLPDRMPQYEESTVRSKEDVKQLNENRQGSLLDFIEDFTNRFPAYVDEYETLLTDNRIWKQRTVGIGVVSPERAMALGMTGPMLRGSGVAWDLRKKQPYEVYDRLDFDIPIGVNGDCYDRYLVRIEEFRQSNRIIKQCIDWLRKNPGPVISDNTKVAPPPREEMKHDMEALIHHFKLFTEGFHVPAGEAYAAVEHPKGEFGIYLISDGANKPYRLKIRAPGFAHLAALDEMTRGHMIADLVAIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.319 kDa

MAEIKNYTLNFGPQHPAAHGVLRLILELDGEVIQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDYVSMMCNEHAYCLAIEKLLGVDVPVRAQYIRVMFSEITRILNHLLWIGAHGLDCGAMNILIYAFREREDLFDMYEAVSGARMHAAYFRPGGVYRDLPDTMPQYRVSKIRNAKALAKMNENRQGSLLDFIEDFCRRFPKNVDDYETLLTDNRIWKQRTVGIGVVTPERALNLGFTGPMLRGSGIAWDLRKTQPYDVYDRVDFDIPVGAGGDCYDRYLVRVEELRQSNRIIQQCAAWLRANPGPVITDNHKVAAPGRVDMKSNMEELIHHFKLFTEGFHVPEGEAYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGFAHLAAMDEMSRGHMIADAVAVIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.779 kDa

MAEFQSYTLNFGPQHPAAHGVLRLVLEMEGEAVRRADPHIGLLHRATEKLAESKPYNQSIGYMDRLDYVSMMCNEHGYVRAIEKLLGIEPPLRAQYIRTMMDEVTRILNHLMWLGGHGLDVGAMTAFLYTFREREDLMDVYEAVSGARMHATYYRPGGVHRDLPDQMPKYEPSAYRSDKELREMNRAREGSVLDFLDDFCERFPACVDEYETLLTENRIWKQRLVDICPVSAERAVELGFTGPLLRGSGVAWDLRKKQPYAAYDRVDFDIPVGVNGDSYDRYLVRVEEMRQSVRIIKQCVDWLRANPGPVRIDDPKVTPPTREEMKDDMESLIHHFKLFTEGYCTPPGEVYAAVEAPKGEFGVYLISDGANKPYRLKVRPPCYYHLAATDEMIRGYMLADVVTLIGSLDVVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.728 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTYLQSVPYMDRLDYVSMMCNEHAYVMSIEKMLNLEVPLRAQYIRVMFDEITRILNHLMWLGAHALDVGAMGVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPDAMPQHKASIIRNAKAINKLNENRQGSLLDFIEDFTNRFPTYVDEYETLLTDNRIWKQRLVGVGVVSPERAMAMGFTGPMLRGSGIEWDLRKKQPYEVYDLLDFDIPVGTNGDCYDRYLVRVEEMRQSNRIIKQCVEWLRNNPGSVMTDNHKVAPPSRVDMKSNMEDLIHHFKLFTEGFHVPVGEAYAAVEHPKGEFGVYLISDGANKPYRMKIRAPGFPHLQGLDEMAKGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.631 kDa

MSEIRNYTLNFGPQHPSAHGVLRLVLELDGETIVRSDPHIGLLHRGTEKLAEYKPFNQSIGYMDRLDYVSMMANEHAYVMGIEKMLGIEVPERAQYIRVMFDEITRILNHLMWLGAHALDIGAMTVFLYAFREREDLMDCYEAVSGARMHATYYRPGGVYRDLPDTMAKYEESKWHSGKKLDQLNETREGSLLDFIEAFTERFPGYVDEYETLLTDNRIWKQRTVDIGIVSPERALQLGFTGPMLRGSGIAWDLRKKQPYEVYDKLDFDIPVGATGDCYDRYLVRVAEMRESNKIIKQCVKWLKENPGPVISDDHKVTPPSREDAKSNMEALIHHFKLFTEGYSVPEGESYTAVEHPKGEFGIYMVSDGANKPYRLKVRAPGFAHLASLDEMAKGHMIADVVAIIGTQDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.635 kDa

MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTYLQSVPYMDRLDYVSMMCNEHAYVMAIEKMLNIEVPLRAQYIRVMFDEITRILNHLMWLGAHALDVGAMGVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDLPDTMPQHKASIIRNAKAISQLNENRQGSLLDFIEDFTNRFPTYVDEYETLLTDNRIWKQRLVGIGVVSPERAMAMGFTGAMLRGSGVEWDLRKKQPYEVYDLMDFDIPVGTNGDCYDRYLVRVEEMRQSNRIIKQCVEWLRNNAGPVMTDNHKVAPPSRVGMKSNMEDLIHHFKLFTEGFHVPTGEAYAAVEHPKGEFGVYLISDGANKPYRMKIRAPGFPHLQGLDEMAKGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.119 kDa

MAEVRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDYVSMMANEHGYVLAIEKLLGIEPPIRAKYIRTMFDEITRILNHLLWLGAHALDVGAMTVFLYCFREREDLMDCYEAVSGARMHATYYRPGGVYRDLPDSMPKYKPSRWHNEKAVKKMNEAREGSLLDFIWDFTARFPNLIDEYESLLTDNRIWKQRTVGIGVVSAERALQLGFTGPMLRASGVEWDLRKKQPYAAYDRVDFDIPIGREGDCYDRYLVRIEEMRQSNRIIRQCVEWLRKNPGSVMIDDYKIVPPQREVMKRDMEALIHHFKLFTEGYIVPEGEAYAAVEQPKGEFGVYIVSDGANKPYRVKVRAASYPHLAAMNEMCRGHMIADLVAIISSIDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.119 kDa

MAEVRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDYVSMMANEHGYVLAIEKLLGIEPPIRAKYIRTMFDEITRILNHLLWLGAHALDVGAMTVFLYCFREREDLMDCYEAVSGARMHATYYRPGGVYRDLPDSMPKYKPSRWHNEKAVKKMNEAREGSLLDFIWDFTARFPNLIDEYESLLTDNRIWKQRTVGIGVVSAERALQLGFTGPMLRASGVEWDLRKKQPYAAYDRVDFDIPIGREGDCYDRYLVRIEEMRQSNRIIRQCVEWLRKNPGSVMIDDYKIVPPQREVMKRDMEALIHHFKLFTEGYIVPEGEAYAAVEQPKGEFGVYIVSDGANKPYRVKVRAASYPHLAAMNEMCRGHMIADLVAIISSIDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.833 kDa

MADIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTWIQSVPYMDRLDYVSMMVNEHAYVMAIERLLGLEVPIRAQYIRVMFDEITRLLNHLMWIGSHALDVGAMAVFLYAFREREDMFDMYEAVSGARMHAAYYRPGGVYRDLPDTMPQYRASKVHNEKAIKVMNEARSGSLLDFIEDFTNRFPTYVDEYETLLTDNRIWKQRLVDIGVVTPERALQMGFTGPMLRGSGIEWDLRKKQPYEVYDKMDFDIPVGTAGDCYSRYLVRVEEMRQSNRIIKQCIDWLRRNPGPVITENHKVAPPSRVDMKSNMEELIHHFKLFTEGIHVPAGEAYAAVEHPKGEFGIYAISDGANKPYRLKIRAPGFVHLAALDEMARGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.828 kDa

MADIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTWIQSVPYMDRLDYVSMMVNEHAYVMAIERLLGLEVPVRAQYIRVMFDEITRLLNHLMWIGSHALDVGAMAVFLYAFREREDMFDMYEAVSGARMHAAYYRPGGVYRDLPDTMPQYRASKVHNERAIKAMNEARSGSLLDFIEDFTNRFPKYVDEYETLLTDNRIWKQRLVDIGVVSPERALQMGFTGPMLRGSGIEWDLRKKQPYEVYDKLDFDVPVGVGGDCYARYLVRVEEMRQSNRIIRQCVEWLRRNPGPVITDNHKVAPPSRVDMKSNMEELIHHFKLFTEGMHVPEGEAYAAVEHPKGEFGIYAISDGANKPYRLKIRAPGFPHLAALDEMAKGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.801 kDa

MADIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKSWIQNVPYMDRLDYVSMMSNEHAYVMAIERLLGIEVPIRAQYIRVMFDEITRLLNHLMWIGAHALDVGAMAVFLYAFREREDMFDMYEAVSGARMHAAYYRPGGVYRDLPDTMPQYRASKVHNERAIKVMNEARSGSLLDFIEDFTNRFPKYVDEYETLLTDNRIWKQRLVDIGVVSPERALQMGFTGPMLRGSGIAWDLRKKQPYEVYDKMDFDVPVGVGGDCYARYLVRVEEMRQSNRIIKQCIEWLRRNPGPVITDNHKVAPPSRVDMKSNMEELIHHFKLFTEGMHVPEGEAYAAVEHPKGEFGIYAISDGANKPYRLKIRAPGFPHLAALDEMAKGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.698 kDa

MADIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTWIQSVPYMDRLDYVSMMVNEHAYVMAIERLLGLEVPVRAQYIRVMFDEITRLLNHLMWIGSHALDVGAMAVFLYAFREREDMFDMYEAVSGARMHAAYYRPGGVYRDLPDTMPQYRASKVHNERAIKAMNEARSGSLLDFIEDFTNRFPKYVDEYETLLTDNRIWKQRLVDIGVVSPERALQMGFTGPMLRGSGIAWDLRKKQPYEVYDKLDFDVPVGVGGDCYARYLVRVEEMRQSNRIIKQCVDWLRRNPGPVITENHKVAPPSRVDMKSNMEELIHHFKLFTEGIHVPEGEAYAAVEHPKGEFGIYAISDGANKPYRLKIRAPGFAHLAALDEMAKGHMIADAVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.608 kDa

MADIRNFTLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAETRTWVQSVPYMDRLDYVSMMCNEHAYCLATEKLLGIEVPERGKYIRVMFDEVTRILNHLLWIGCHALDVGAMTMALYTFREREDLMDVYEAVSGARMHAAYYRPGGVYRDLPDRMPQYQESTWTNAKKAAEKNENRSGSVLDFLEDFTNRFPTYHSEYHTLLTDNRIWKQRLVNVGVVTPERALQMGFTGAMLRGSGIAWDLRKKQPYAAYDKINFDVPVGVNGDSYDRYLVRMEEMIQSNNIIKQCIAWLRKNPGPVITDNNKVAPPPRENMKTNMEELIHHFKLFTEGIHVPAGEAYAAVEHPKGEFGIYFVSDGANKPYRMKIRAPGFVHLAGLDEMSRGHMIADVVTIIGSQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.58 kDa

MAEIKNYSLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDYVSMMCNEHAYCLAIEKLLGIEVPIRAQYIRVMYSEITRIMNHLMWLGSSGNDAGSSTTLIYTFREREDLMDMYEAVSGARMHAAYFRPGGVYRDLPDTMPQYKASKVRNARSVEIMNRNRHGSLLDFIDDFTQRFPKCADEYETLLTDNRIWKQRNVDIGVVTAERAMNLGLTGPMLRASGVAWDMRKSQPYEVYDRMDFDVPVGKTGDCYDRYLVRVAEMRQSNRIIKQCVDWLRANPGPVIVDNHKIAPPPREGMKSNMEELIHHFKLFTEGFRVPEGEAYAAIEHPKGEFGIYIVSDGANKPYRLKIRPPGFANLSAMDELCRGHMLADAVMVLSTLDIVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.768 kDa

MAEIRNYTLNFGPQHPAAHGVLRLILEIDGEVIERADPHIGLLHRGTEKLVESKPYNQSIGYMDRLDYVSMMCNEHAYIMAIETMLGIKVPERAQYIRVMFDEITRILNHLMWLGTHGLDVGAMSIFLYAFREREKLIDCYEAVSGSRMHATYYRPGGVYRDLPDKMPQYLASGFRTDKELKTMNENRQGSLLDFIADFVKEFPKSIKQYDDLLTDNRIWKQRLVNIGIVSANRAKQLGFTGPMLRGSGVAWDLRKNQPYAVYDQLEFDIPVGVTGDSYDRYLVRMEEMRQSNHIIKQCVKWLQGNPGAVMSDDHKVSPPKRTDMKGDMESLIHHFKLFTEGYCLSEGEIYRAVEHPKGEFGIYLISDGANKPYRVKIRAPGFAHLAAMNEMARGHMLSDVVTIIGTQDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.442 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGETVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLELEVPERAQYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYKQTRFTSKRKTKKINANRQGSMLDFLDSFVVDFDKSLDEIDTLLTDNRLWKQRTVDIGVVTAERAVELGFTGPMLRGSGVAWDLRKSQPYEVYDKLDFDIPVGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANQGPVLSDNHKVAPPKRNAMKNNMEELIHHFKLFSEGYCTPEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMKAPGFTHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.573 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANPGPVLSDNNKVAPPKRNAMKNNMEELIHHFKLFSEGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.586 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANPGSVLSDNHKVAPPKRNAMKNNMEELIHHFKLFSEGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.586 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANPGSVLSDNHKVAPPKRNAMKNNMEELIHHFKLFSEGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.596 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANPGPVLSDNHKVAPPKRNAMKNNMEELIHHFKLFSEGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.592 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANPGPVLSDNHKVAPPKRNAMKNNMEELIHHFKLFSEGYCTPEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.586 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANPGSVLSDNHKVAPPKRNAMKNNMEELIHHFKLFSEGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.573 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANPGPVLSDNNKVAPPKRNAMKNNMEELIHHFKLFSEGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.596 kDa

MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEMTRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWLRANPGPVLSDNHKVAPPKRNAMKNNMEELIHHFKLFSEGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLADTPAIISTIDVVFGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

416 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.777 kDa

MAEAPMAQAPTAQAPTAEAAAEAPGLRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVAPMNQEHAFCLAVEKLLGIAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMMFYERASGSRMHAAYFRVGGVHQDLPPQLVADIDSWCDSFIQVVDDLETLLTDNRIFKQRNVDIGVVTLEQAWEWGFSGVMVRGSGAAWDLRKSQPYECYAEMDFDIPIGKNGDCYDRYCLRVEEMRQSIRIMKQCIAKLRAPDGQGRVAIDDNKIFPPRRGEMKRSMESLIHHFKLYTEGFRVPEGEVYVAVEAPKGEFGVYLVSDGSNKPYKCKIRAPGFAHLQAMDFICRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

416 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.903 kDa

MTGSNSPAAATDFFHDAPSLPAVPETPVRKFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLMEARTYLQNIPYFDRLDYVAPMNQEHAFCLAIEKLLGVDVPLRGSLIRVLFCEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARLHANYFRPGGVHQDLTPSLIDDIEKWAKAFPKICDDIEGLITDNRIFKQRNVDIGVVTKEDALAWGFSGVMVRGSGIAWDLRRNQPYECYNDFEFDIPLGKNGDCYDRYLCRMQEMRESTKIILQAIEKLRATPGPVMTQDNKVAPPRRAEMKRSMEALIHHFKLYTEGFRTPEGEVYACVEAPKGEFGVFLVSNGTNKPYRCKIKAPGFSHLAAMDWMNRGHQLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

416 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.896 kDa

MSDIVLHEDIPESLLPGGEAAAAATHTVEIDSHALNFGPQHPSAHGVLRLVLEMEGEVVARAIPHIGLLHRGTEKLIEYKTYPKALPYFDRLDYVSPMCEEQAFALATEKLLGIDIPDRAKWIRVMFAEITRILNHILNLTALGLDCGAVTPALWGYEEREKLIEFYEAASGARFHANYFRPGGVSRDLPAGLEDRIAEWARQFPAWIDDLESLLTNNRIWKQRTVGIGIFTTEQALAWGFSGPCLRASGVPWDLRRAQPYDNYDKVEFNIPVARQGDCYDRYLIRVAEMRESVRIVEQCLAQMKPGPIKIQDHKITPPPRREMKRSMEALIHHFKLFTEGYHVPPGATYTAVESPKGEFGVYLVADGSNRPYRCKIRPTGFAHLQAIDEMSRRHMLADAVAIIGSLDLVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

415 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.352 kDa

MADTLKPEAPNPDTDAYAHESELDAHLQTKRMVINMGPSHPATHGTVRLKVELEGETIVKIDPEIGFLHRGFQKSCENVTWTQCLPYTDRLNYLSAMMNNFGFLNAVEKLIGLEIPERAQYIRVIGSELHRLTDHLTCVGATGLEMGGFAPFLLAMEFRELLHDRTAELTGARLTTSFGRVGGSNRDLPEGWIPRVHKTLDQGLALLDEMEGLLTNNRIFVDRTKGTGVISAEDAIEYGYTGPALRACGVDYDIRKTKPYWVYDRFDFDIPVGEHGDNYDRYLVRLEEMRQSIRILRQAMDTIPAGPIIVDDWRIALPPKPEVYGTIEGVMSHFKLVMEGIQVPAGEVYDATEASNGELGWYLVSDGRGRPYKVHVRAPGFPVLAAVPHIIEGKMLADLIPTFDTINMIGGEVEQ

nuoD

NADH-quinone oxidoreductase subunit D

414 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.175 kDa

MKTSTKTFAIADTAANADYLTNTSEPLGETMTLNVGPSHPATHGVLRLVLELDGEEIISCDPVVGHLHRGMEKIGETIQYNQFVPYTDRFDYLAPLSNNIAYACAVEKLLGWELPPRGQALRVLALELSRFSSHILGVGVYGMDVGAMTVFLYCYEEREKIHNFYEQLTGARFTSSYTRIGGQTRDVPNEMLKEVLVFCDEAAKTLDETEALLLKNKIFIDRLQGVGVISREKALSWGITGANLRASGIKRDLRKLTPYLGYENYEFDVPVGEHGDCYDRFTVRIEEMRQSLRIIRQVIETMPDGPINMVDTKGTLPEKKKVLTDMESLIRQFMTTTMGVNAPAGQVYFAAENPKGELGFFLDSKGGGLPNRLRMRSPSFCNLSILPELMKGHLVSDVPAILGSFDFVMGECDR

nuoD

NADH-quinone oxidoreductase subunit D

413 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.449 kDa

MDGDIRHNSYDDGSEDVLTGEQSIRNFNINFGPQHPAAHGVLRMVLELDGEIVERADPHIGLLHRGTEKLMESRTYLQNTPYFDRLDYVAPMNQEHAWCLAIEKLTGTAVPRRASIIRVLFSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMIFYERACGARLHANYFRPGGVHQDLPPDLIDDIEIWAKAFPQVLDDIEGLLTENRIFKQRNADICIITEAEIEKWGYSGVMVRGSGLAWDLRRAQPYECYDEFDFKVAVGKNGDCYDRYLVRMAEMRESTKIILQACAKLRAPDGQGDILARGKLTPPKRAEMKTSMEALIHHFKLYTEGFKVPAGEVYAAVEAPKGEFGVYLVADGTNKPYRAKIRAPGYAHLQSIDAVAKGHQLADVSAIIGTMDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

412 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.724 kDa

MDGDIRKNSYDDGSMDALTGEQSIRNFNINFGPQHPAAHGVLRMVLELDGEIVERADPHIGLLHRGTEKLMESRTYLQNLPYLDRLDYVAPMNQEHAWCLAIERLTGTVIPRRASLIRVLYSEIGRILNHLMGVTTGAMDVGALTPPLWGFEAREELMIFYERACGARLHAAYFRPGGVHQDLPPDLLDDIEEWCERFPKLVDDLDTLLTENRIFKQRLVDIGIVTEADALDWGYTGVMVRGSGLAWDLRRSQPYECYDEFDFQIPVGRNGDCYDRYLCRMAEMRESCKIMQQAVQKLRAEPAGDVLARGKLTPPRRAEMKRDMESLIHHFKLYTEGFKVPAGEVYAAVEAPKGEFGVYLVADGTNKPWRAKLRAPGFAHLQSIDWMSRGHMLADVPAIIATLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

412 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.982 kDa

MMDGDIRVNTYDDGSTDFQTGEQKIRNFNLNFGPQHPAAHGVLRLVLELDGEICERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVGTMNQEHAWCLAIERMTGTDVPRRAQLIRVLYCEIGRILNHLLNVTTQALDVGALTPPLWGFEEREKLMIFYERASGARLHAAYFRPGGVHQDLPPELIEDIDTWAHEFPQMLDDIDGLLSENRIFKQRNVDIGVVTEEDIQNWGFSGVMVRGSGFAWDLRRAQPYECYDEFEFQIPVGKNGDCYDRYLCRMAEMRESTKIIHQACEKLRNEPGEIMSRGKMSPPSRGDMKTSMEALIHHFKLYTEGFHVPEGEIYACVEAPKGEFGVFLVADGTNKPYRAKLRAPGFAHLQAMDYLCKGHQLADVSAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

412 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.681 kDa

MQVKNRLTPFFENITFDREDNEMILNFGPQHPSAHGQLRLMLHLQQEMIVKAHPDIGYLHRGMEKMAENMIYNEFMPTTDRMDYIASSANNYGFALAVERLIGLEVPRRAKVIRMMLLEINRLMSHLFWLATTALDIGAMTVFLFAFREREYLMDIMEGYCGARLTHAAIRIGGVPLDIQDTFITQLKTFLDKLPQNIKDYEDLLDTNRIWLMRMEEVGVISKEMALSWGCSGPMLRASGVAWDIRKEEPYELYDEVEFRVPYSDKGDNFARYRIYMEEMRESAKILYQTIDMYEKCVKDNQTELMAHAPKYISAPKLDIMTQNYSLMQHFVLVTQGMRPPVGEVYVATESPKGELGFYINSQGGPYPYRLKLRAPSFWHTGILTDILPGHYIPDVVSIIGTTNIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

412 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.224 kDa

MSELLLPPEHRYAKIIKERHNEDGSELSVLNLGPTHPATHGIFQNILLMDGERILEAEPTIGYIHRAFEKIAENRPFYQITPLTDRMNYCSSPINNMGWWMTLEKLLGIEVPKRAQYLRVIVMELARITDHIICNSILGVDTGAYTGFLYVFQFREKIYEIYEEICGARLTTNMGRIGGFERDWSPEAFRKLDKFLEEFPPAWKEFENLFERNRIFLDRTVNVGGITAEKAMAYGFTGPNLRAAGVDYDVRVAHPYSSYEDFDFIVPVGKSGDTYDRFCVRNAEVWESLSIIRQALEKMPAGNEYHAEVPDYYLPPKEDVYNSMESLIYHFKIVMGEVPVPVSEIYHAVEGGNGELGFYLATDGSRTPYRLHFRRPCFIYYQAFPEMIKGALLSDAIIILSSLNVIAGELDA

nuoD

NADH-quinone oxidoreductase subunit D

412 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.244 kDa

MSELLLPPEHRYAKIIKEKLNEDGSELSILNLGPTHPATHGIFQNILLMDGERIVDAEPTIGYIHRAFEKIAENRPFYQITPLTDRMNYCSSPINNMAWWMTLEKLLDIEVPKRAQYLRVIVMELARITDHIICNSILGVDTGAYTGFLYVFQFREKIYEIYEEICGARLTTNMGRIGGFERDWSPKAFQLLNTFLEEFPIAWKEFENLFERNRIFIDRTVNVGAISAEKAMAYGFTGPNLRAAGIDYDVRVAEPYSSYEDFEFIIPVGKSGDTYDRFCVRNAEVWESLSIIRQALAKMPEGNVYHAEVPDYYLPPKEDVYHNMESLIYHFKIVMGEVPVPVAEIYHAVEGGNGELGFYLTTDGSRTPYRLHFRRPCFIYYQAYPEMIKGALLSDAIVILSSLNVIAGELDA

nuoD

NADH-quinone oxidoreductase subunit D

411 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.545 kDa

MTGQTAPAAPEDANVLGLPETKVRKFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEARPYAQTIPYFDRLDYVAPMNQEHAYCLAIEKLLGVEVPVRGLLIRTLYDEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMIFYERASGARLHANYYRVGGVRQDLPPELVQDISDWCDAFPKILDDIEGLITDNRIFKQRNVDIGVVTKEEAIAWGFSGVMVRGSGIPWDLRRSQPYALYSEMEFDIPLGVNGDCYDRYLCRMQEMRESTKIMKQCCERLLKTSGPVLVDDHKVSPPRRGEMKRSMEALIHHFKLYTEGYRTPPGDVYACVEAPKGEFGVYLVSNGTNKPYRCKIRAPGYPHLQAMDWMNRGHMLADVSAILGSLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

410 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.672 kDa

MQQRNRLEPYFENLVFERDDNKMVVNFGPQHPSAHGQLRLILEMDGEQITKAVPDIGYLHRGMEKMGENMIYNEFLPTTDRMDYIAATSNNYAFALAVERLLGIEDKVPRRAKVIRMILLELNRIISHLFWLATHALDVGAMSVFLYCFREREYAMDLIEDYCGARLTHSSVRIGGVPLDLPEGWLDRLNVYLNNLPDQIKLYEGLLTENRIWRMRLEEVGVIPPEMAKQWACSGIMLRGSGIEYDIRKEEPYELYDEVDFDIPVSDRCDSYGRYLLYMEEMRQSIRIIRQLIPMYKETEPQLMAHAPEYISAHKEDIMTQNYSLMQHFVLVTQGMRPPVGEVYVPTESPKGELGFFIRSEGEPYPYRLKIRAPSFWHTGILQDLLPGHYLADVVTIIGSTNIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.184 kDa

MSQAPNRLKPFFENLEFEQNDGKMILNFGPQHPSAHGQLKLVLELDGEKVVRAMPEVGFMHRGVEKMAENMTYQEFIPVTDRVDYIASSANNYAFCAAVEKLCAIEVPRRAQIIRVMLLELNRISSHLLFLATHALDVGAMSVFLYAFREREYVLDLIEKYCGARLTHSSIRIGGVPLDLPDGWCEELLKFCEKFPSDITLYEDLLSANRIWQARLIDVGVVSKELALSSGCSGVMLRASGIARDIRKEEPYLIYDELEFDVPYATKGDCYARYLLYMKEMRECVKILKQCVSKYQTSSPAIIADAPEYVSASKEQIMSQNYSLMQHFVLITQGLKPPKGEIYFASESPKGELGIYINSDGSASPYRLKIRTPSFWHCAIYEDMLVGQYVADVAAIIGSTNIILGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.909 kDa

MSQAPNRLTPFFENIEFERNDGKMILNFGPQHPSAHGQLKLVLELDGEKVVRAMPEVGFMHRGIEKMAENMTYQEFIPVTDRVDYIASVANNYAFCEAVERLCEIKVPRRAQIIRVILLELNRISSHLLFLATHALDIGAMTVFLYAFREREYVLDMIEKYCGARLTHSAVRIGGMPLDLPEGWFEEMLKFCEKFPKDIKIYEDLLSENRIWKMRLENVGVISKELALSSGCSGVMLRASGVKWDIRKEQPYLVYDEIDFEVPYAVAGDCYARYVLYMREMKECVKILKQCERLYRASSREILADAPEFVSPSKEQIMTQNYSLMQHFVLITQGIKPKRGEIYFASESPKGELGIYINSQGEASPYRLKIRTPSFSHCAIYEDLLVGQYIADIAAIIGSTNIILGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.69 kDa

MAQNFTKLNPQFENIIFEHDDNQMVLNFGPQHPSSHGQLRLILELEGERIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDYTSSASNNYAYAHAVETLLNLEIPRRAQVIRTILLELNRMISHIFFISVHALDVGAMSVFLYAFKTREHGLDLMEDYCGARLTHNAIRIGGVPLDLPPNWLEGLKKFLGEMRECKKLIQGLLDKNRIWRMRLENVGVVTPKMAQSWGMSGIMLRGTGIAYDIRKEEPYELYRELDFDVPVGNYGDSYDRYCLYMLEIDESIRIIEQLIPMYAKTDTPIMAQNPHYISAPKEDIMTQNYALMQHFVLVAQGMRPPIGEVYAPTESPKGELGFFIHSEGESYPHRLKIRAPSFYHIGSLGDILVGQYLADAVTVIGSTNAVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.902 kDa

MKQNYTKLKPNFENIFFEQENDKMILNFGPQHPSAHGQLRLILELENEKIIKATPDIGYLHRGIEKMAENMIYNEFMPTTDRLDYIAATSNNYAFALGVEKLIGVDIPLRAQVIRTMLLEINRIISHIFLLGVQGMDVGALSIFLYCFIEREYGLDLMEDYCGARLTHNAIRIGGVPLDLPHNFLESVEKFTHSVPKTLDLVRGLLDKNRIWRIRLENVGYISQDFAKQWSLSGIMARGSGIKWDIRKHNPYELYSELDFEVPIATEGDCYARYQLYIEEIYESLKIIKQLIAMYPSTPKEIMAKDARYISAPKEDIMTQNYSLMQHFVLVTQGMRPPVGEVYVPTESPKGELGFFINSQGAPSPHRLKIRTPSFYHIGVLQELLIGHYFADIPAILASTNVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.74 kDa

MAQNFTKLNPQFENIIFEHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDYTSSTSNNYAYAYAVETLLNLEIPRRAQVIRTILLELNRMISHIFFISVHALDVGAMSVFLYAFKTREYGLDLMEDYCGARLTHNAIRIGGVPLDLPPNWLEGLKKFLGEMRECKKLIQGLLDKNRIWRMRLENVGVVTPKMAQSWGMSGIMLRGTGIAYDIRKEEPYELYKELDFDVPVGNYGDSYDRYCLYMLEIDESIRIIEQLIPMYAKTDTPIMAQNPHYISAPKEDIMTQNYALMQHFVLVAQGMRPPVGEVYAPTESPKGELGFFIHSEGEPYPHRLKIRAPSFYHIGALSDILVGQYLADAVTVIGSTNAVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.754 kDa

MAQNFTKLNPQFENIIFEHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDYTSSTSNNYAYAYAVETLLNLEIPRRAQVIRTILLELNRMISHIFFISVHALDVGAMSVFLYAFKTREYGLDLMEDYCGARLTHNAIRIGGVPLDLPPNWLEGLKKFLGEMRECKKLIQGLLDKNRIWRMRLENVGVVTPKMAQSWGMSGIMLRGTGIAYDIRKEEPYELYKELDFDVPVGNYGDSYDRYCLYMLEIDESIRIIEQLIPMYAKTDTPIMAQNPHYISAPKEDIMTQNYALMQHFVLVAQGMRPPIGEVYAPTESPKGELGFFIHSEGEPYPHRLKIRAPSFYHIGALSDILVGQYLADAVTVIGSTNAVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.785 kDa

MAQNFTKLNPQFENIIFEHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDYTSSTSNNYAYAYAVETLLNLEIPRRAQVIRTILLELNRMISHIFFISVHALDVGAMSVFLYAFKTREYGLDLMEDYCGARLTHNAIRIGGVPLDLPPNWLEGLKKFLGEMRECKKLIQGLLDKNRIWRMRLENVGVVTQKMAQSWGMSGIMLRGTGIAYDIRKEEPYELYKELDFDVPVGNYGDSYDRYCLYMLEIDESIRIIEQLIPMYAKTDTPIMAQNPHYISAPKEDIMTQNYALMQHFVLVAQGMRPPIGEVYAPTESPKGELGFFIHSEGEPYPHRLKIRAPSFYHIGALSDILVGQYLADAVTVIGSTNAVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.74 kDa

MAQNFTKLNPQFENIIFEHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDYTSSTSNNYAYAYAVETLLNLEIPRRAQVIRTILLELNRMISHIFFISVHALDVGAMSVFLYAFKTREYGLDLMEDYCGARLTHNAIRIGGVPLDLPPNWLEGLKKFLGEMRECKKLIQGLLDKNRIWRMRLENVGVVTPKMAQSWGMSGIMLRGTGIAYDIRKEEPYELYKELDFDVPVGNYGDSYDRYCLYMLEIDESIRIIEQLIPMYAKTDTPIMAQNPHYISAPKEDIMTQNYALMQHFVLVAQGMRPPVGEVYAPTESPKGELGFFIHSEGEPYPHRLKIRAPSFYHIGALSDILVGQYLADAVTVIGSTNAVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.7 kDa

MAQNFTKLNPQFENIIFEHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDYTSSTSNNYAYAHAVETLLNLEIPRRAQVIRTILLELNRMISHIFFISVHALDVGAMSVFLYAFKTREYGLDLMEDYCGARLTHNAIRIGGVPLDLPPNWLEGLKKFLGEMRECKKLIQGLLDKNRIWRMRLENVGVVTPKMAQSWGMSGIMLRGSGIAYDIRKEEPYELYKELDFDVPVGNYGDSYDRYCLYMLEIDESIRIIEQLIPMYAKTDTPIMAQNPHYISAPKEDIMTQNYALMQHFVLVAQGMRPPVGEVYAPTESPKGELGFFIHSEGEPYPHRLKIRAPSFYHIGALSDILVGQYLADAVTVIGSTNAVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.757 kDa

MAQNFTKLNPQFENIIFEHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDYTSSTSNNYAYAYAVETLLNLEIPRRAQVIRTILLELNRMISHIFFISVHALDVGAMSVFLYAFKTREYGLDLMEDYCGARLTHNAIRIGGVPLDLPPNWLEGLKKFLGEMRECKKLIQGLLDKNRIWRMRLENVGVVTQKMAQSWGMSGIMLRGTGIAYDIRKEEPYELYKELDFDVPVGNYGDSYDRYCLYMLEIDESVRIIEQLIPMYAKTDTPIMAQNPHYISAPKEDIMTQNYALMQHFVLVAQGMRPPVGEVYAPTESPKGELGFFIHSEGEPYPHRLKIRAPSFYHIGALSDILVGQYLADAVTVIGSTNAVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.947 kDa

MQQPNKLTPFFENLNFERDDNTMVINFGPQHPSAHGQLRLVLELEGEQVVKAYPDIGYLHRGIEKMAENMTYNEFLPTTDRLDYIASTANNYAYALAVEKLLGIEAPRRAQVIRTMLLEINRLISHLFFIATHALDVGAMSVFLYAFREREFGMDLMEDYCGARLTHSAVRIGGVPLDLPNGWIEKMISWCDKVDHELEHTYNALLQENRIWKMRLEDVGVISAEDALSWGCTGPMLRGSGVNWDIRKEEPYELYGELDFDIPVSDRCDSYGRYRLYMEEMHQSTRILRQLVSKYKESEPQLMAHAPQYISAPKEEIMTQNYALMQHFVLVTQGMRPPKGEVYVPTESPKGELGFYIKSEGEPYAYRLKCRAPSFFHTGLLQEILVGTYIADVVTIIGSTNIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

409 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.423 kDa

MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKFLEVMPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

408 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.445 kDa

MQDPNKLRPFFENVEFNREGSNMILNFGPQHPSAHGQLKLVLEVDGEKIIKARPGIGYMHRGVEKMAENMIYQEFVPVTDRVDYIAAGSNNYGFCATVEKLCGIDVPRRAQIIRTMLLELNRIASHLLFLGTHALDIGAMTVFLYTFREREYVLDLIEKYSGARLTHHNVKIGGMFVDLPDGWLDELLAFCEKFPRDIADYEALLDTNRIWLLRTQNVGVITKEQALSCGCSGVMLRASGYKWDIRKEEPYLIYDELDFDVPYAEAGDCYARYKCYVQEMRESVKILTQCVPLYKASEPKILADSPEFVSAGKEQLMSQNYSLMQHFVLITQGLKPPEGEIYLATESPKGELGFYIYSVGESSPYRLKIRCPSFWHCAIYEEIMPGQYIADVTAIIGSSNIILGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

408 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.915 kDa

MQIPSKLKPYYENIAFEQEDSKMIINLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDYIAASANNYAYCAAVEKLCGLEIPRRAAVIRMILLELNRIASHLLWLATHALDIGAMSVFLYCFREREYVLDLIEKYCGARLTHSSMRIGGVMLDLPENYLEEMLVFCDKFPNDLKDYEDLLDDNRIWRLRTENVGVVTKEQALNWGCTGVMLRGSGIKYDIRKEEPYLLYNEVEFGVPYATQGDSYARYKVYMQEFRESLKILRQCATLYKDTPPEILATHPEYVSASKEQILTQNYSLMQHFVLITQGLKPPKGEVYVPTESPKGELGFFIHSDGTGRPYRLKARTPSYWHCAFFEEMLVGTYLADVVAIMGNVNIVLGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

408 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.945 kDa

MQIPSKLKPYYENIAFEQEDSKMIINLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDYIAASANNYAYCAAVEKLCGLEIPRRAAVIRMILLELNRITSHLLWLATHALDIGAMSVFLYCFREREYVLDLIEKYCGARLTHSSMRIGGVMLDLPENYLEEMLVFCDKFPNDLKDYEDLLDDNRIWRLRTENVGVVTKEQALNWGCTGVMLRGSGIKYDIRKEEPYLLYNEVEFGVPYATQGDSYARYKVYMQEFRESLKILRQCATLYKDTPPEILATHPEYVSASKEQILTQNYSLMQHFVLITQGLKPPKGEVYVPTESPKGELGFFIHSDGTGRPYRLKARTPSYWHCAFFEEMLVGTYLADVVAIMGNVNIVLGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

408 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.937 kDa

MQIPSKLKPYYENIAFEQEDSKMIINLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDYIAASANNYAYCAAVEKLCGLEIPRRAAVIRMILLELNRITSHLLWLATHALDIGAMSVFLYCFREREYVLDLIEKYCGARLTHSSMRIGGVMLDLPENYLEEMLAFCDKFPNDLKDYEDLLDDNRIWRLRTENVGVVTKEQALNWGCTGVMLRGSGIKYDIRKEEPYLLYNEVEFGVPYATQGDSYARYKVYMQEFRESLKILRQCAMLYKDTSPEILATHPEYVSASKEQILTQNYSLMQHFVLITQGLKPPKGEVYVPTESPKGELGFFIHSDGTGRPYRLKARTPSYWHCAFFEEMLVGTYLADVVAIMGNVNIVLGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

408 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.009 kDa

MQIPSKLKPYYENIAFEQEDSKMIINLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDYIAASANNYAYCAAVEKLCGLEIPRRAAVIRMILLELNRITSHLLWLATHALDIGAMSVFLYCFREREYVLDLIEKYCGARLTHSSMRIGGVMLDLPENYLEEMLAFCDKFPNDLKDYEDLLDDNRIWRLRTENVGVVTKEQALNWGCTGVMLRGSGIKYDIRKEEPYLLYNEVEFGVPYATQGDSYARYKVYMQEFRESLKILRQCAMLYKDTSPEILATHPEYVSASKEQILTQNYSLMQHFVLITQGLKPPKGEVYVPTESPKGELGFFIHSDGTERPYRLKARTPSYWHCAFFEEMLVGTYLADVVAIMGNVNIVLGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

408 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.937 kDa

MQIPSKLKPYYENIAFEQEDSKMIINLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDYIAASANNYAYCAAVEKLCGLEIPRRAAVIRMILLELNRITSHLLWLATHALDIGAMSVFLYCFREREYVLDLIEKYCGARLTHSSMRIGGVMLDLPENYLEEMLAFCDKFPNDLKDYEDLLDDNRIWRLRTENVGVVTKEQALNWGCTGVMLRGSGIKYDIRKEEPYLLYNEVEFGVPYATQGDSYARYKVYMQEFRESLKILRQCAMLYKDTSPEILATHPEYVSASKEQILTQNYSLMQHFVLITQGLKPPKGEVYVPTESPKGELGFFIHSDGTGRPYRLKARTPSYWHCAFFEEMLVGTYLADVVAIMGNVNIVLGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

408 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.799 kDa

MQIPNRLQPFYENLVFERHDNQMVINFGPQHPSAHGQLRLILELEGEKVTRAVPDVGYLHRGMEKMGENMIYNEFIPTTDRMDYIAASSNNHAFALTVEKLLGIEVPRRAKVIRMMIVELNRIISHLFWLATHALDVGAMSIFLYCFREREFAMDLMEDYCGARLTHSSIRIGGVPLDLPAGWLEKLKSFLEKMPENIALYEGLLSENRIWKMRLENVGIITPEMAKSWGCSGVALRGSGIQWDLRKEQPYELYDEVEFDIPVSDSGDSYGRYKLYMEEMRQTVKILHQLIEMYPSTSSEIMAHAPQYISAPKEQIMTQNYSLMQHFVLVTQGMRPPVGEVYCATESPKGELGFFIRSEGEPYPYRLKIRAPSFYHTGILQDLLPGGYIADVVTIIGNLNIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

407 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.064 kDa

MMDGTKGFEDALTGEQKIRNFNINFGPQHPAAHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHAWCLAIEKLTGVEVPRRASLIRVLFCEIGRILNHILNITTQAMDVGALTPPLWGFEEREKLMVFYERASGARLHAAYFRPGGVHQDLPPALIDDIETWAHEFPRVIDDIDGLLTENRIFKQRNADIGVVTEEDILEYGFSGVMVRGSGLAWDLRRAQPYERYDEFDFQIPIGKNGDCYDRYLVRMEEMRQSLSIILQAIAKLRAPEGQGDVLARGKITPPSRSDMKTSMESLIHHFKLYTEGFHVPAGEVYACVEAPKGEFGVYLVADGTNKPYRAKIRAPGFLHLQAMDHMSRGHQLADVAAIIGTMDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

406 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.899 kDa

MSGGMQNGTQETERRVIDINDRHTVNVGPQHPATHGVLRLIMELEGETVTRADPHIGLLHRGTEKLIEYKSYLQAVPYFDRLDYVSPMCCEHAFALATERLLGVKVPERAQWIRVLFAEITRILNHLLNAVHLALDIGAQSPSLWGYEEREKLLTFHEAVSGARFHANYFRPGGVSKDMPTGLAEQIWEWSEKFPKFLDDLQSLLNENRIFRQRLVDIGVISAEDALAMGFSGPNLRASGIAWDLRRAQPYDKYDEVDFDIPVGRHGDSFDRYLVRIREMAESLKIIRQALKAMPEGPIKVQDHKITPPKRAEMKRSMEALIHHFKLYTEGYHVPAGTTYTAVEAPKGEFGVYLVADGSNRPYRCKIRATGFSHLQAMNLMSKGHLLADAIAVLGSIDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

406 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.379 kDa

MVMYEKTAEHFGQKFKDLPEGHLLVNLGPSHPATHGILQNVIQIDGERVVDTESVIGYVHRCFEKLGERYDYNQFLVCTDRMNYVSTPLNNIGWILTVEKMMQIQVPDRVTYVRMIISELSRIMDHIICNGIMGVDLGAFSGLLHLFHHRENIYQILEKLTGARLTTTFCRVGGMERDIYPEFQTEIKLILKGLKPALDEFEELLIRNKIFNERTKGIGGISADRAIAYGFSGPNLRAAGVPWDVRKDDPYMFYDKVNFDIPVGEDGSALDRTLVRMEEMRQSMKIIEQLIDGIPEGPYHADVPHSFLPPKDRVYHNMEELIYHFKIIMHGVKVPPGEYYHATEAANGELGFYVVSEGDKSPWRVHVRRPCFWYYQAFPEMVKGGLLADTIATMSSLNVIAGELDC

nuoD

NADH-quinone oxidoreductase subunit D

406 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.379 kDa

MVMYEKTAEHFGQKFKDLPEGHLLVNLGPSHPATHGILQNVIQIDGERVVDTESVIGYVHRCFEKLGERYDYNQFLVCTDRMNYVSTPLNNIGWILTVEKMMQIQVPDRVTYVRMIISELSRIMDHIICNGIMGVDLGAFSGLLHLFHHRENIYQILEKLTGARLTTTFCRVGGMERDIYPEFQTEIKLILKGLKPALDEFEELLIRNKIFNERTKGIGGISADRAIAYGFSGPNLRAAGVPWDVRKDDPYMFYDKVNFDIPVGEDGSALDRTLVRMEEMRQSMKIIEQLIDGIPEGPYHADVPHSFLPPKDRVYHNMEELIYHFKIIMHGVKVPPGEYYHATEAANGELGFYVVSEGDKSPWRVHVRRPCFWYYQAFPEMVKGGLLADTIATMSSLNVIAGELDC

nuoD

NADH-quinone oxidoreductase subunit D

406 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.189 kDa

MASTYDTLTPEAQKGEVEIQNYTINFGPQHPAAHGVLRMVMELDGEIVERVDPHVGLLHRGTEKLIEYKTYLQALPYFDRLDYCSPLGMEHSYVLAIEKLLQLEVPLRAQYLRVLFAELTRICNHMLNIGSHVMDVGAMTPNLWLFEIREDCLNFFERASGARMHAAWFRPGGVHQDVPLKLLTDIGDWLDTRLPRLFEDAVSLFADNRIFKQRNVDVGVVSKEDALAWGFSGPMIRAAGIPWDIRKSQPYDVYDRMDFEIPVGTKGDCYDRVMVRIEEVRQSARIMKQCLSEMPEGPIASLDRKVVPPKRGEMKRSMEALIHHFKLYTEGFHVPAGDVYVATESPKGEFGVYLVSDGSNKPYRCKIRPTAFSHLQAMDFMMKGHMLADTTAILSAIDVVFGECDR

nuoD

NADH-quinone oxidoreductase subunit D

405 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.603 kDa

MSITEANALADAPGTRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHAFCLAAEKLLGITVPRRGQLIRVLYSEIGRILSHLLNITTQALDVGALTPPLWGFEEREKLMMFYERASGSRMHAAFFRIGGVHQDLPPKLIGDIDIWCDAFPEKLDDLEILLTDNRIFKQRNVDIGVVTLDQAWEWGFSGVMVRGSGAAWDLRRAQPYECYDEMEFDIPIGKNGDCYDRYCIRVEEMRQSVRIMKQCIAKMRAPDGQGPVVIEDNKITPPRRGEMKRSMEALIHHFKLYTEGVHVPPGEVYAAVEAPKGEFGVYLVADGTNKPYKCKIRAPGFAHLQAMDFICKGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

405 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.083 kDa

MMYEKTAEHFEQKYKNLPEGHLLVNLGPSHPATHGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNYVSTPLNNIGWILAVEKMMQVEVPDRVTYVRMIISELSRIMDHIICLGILGVDLGAFSGMLHLFHHRENIYQIIEKLTGARLTTTFCRIGGLERDIYPEFEKEVKLVCKGLKPAIEEFNSLLLKNKIFLGRTEGIGGISAENAIAYGFSGPNLRAAGVDWDVRKDKPYMLYDKVDFDVPIGEDGSVLHRSLVRMEEMRQSIRIIEQLVDGIPSGAWHADLPHAYLPEKNKVYNNMEELIYHFKIIMHGVKVPPGEHYMATEAANGELGFYIISEGEKSPWRVHVRRPCFWYYQSFAELVRGGLLADSVATMSSLNVIAGELDC

nuoD

NADH-quinone oxidoreductase subunit D

405 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.117 kDa

MMYEKTAEHFEQKYKNLPEGHLLVNLGPSHPATHGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNYVSTPLNNIGWILAVEKMMQIEVPDRVTYVRMIISELSRIIDHIICTGILGVDLGAFSGMLHLFHHRENIYQIIEKLTGARLTTTFCRIGGLEKDIYPDFVKEVKLVCKGLKPAIEEFNSLLLKNKIFLGRTEGIGGISAENAIAYGYTGPNLRAAGVDWDVRKDEPYLFYDKVDFDIPIGEDGSVLHRSLVRMEEMRQSIRIIEQLVDGIPSGPWHADLPHAYLPEKHKVYNNMEELIYHFKIIMHGVKVPPGEYYMATEAANGELGFYIVSEGEKSPWRVHVRRPCFWYYQSFAELVRGGLLADSVATMSSLNVIAGELDC

nuoD

NADH-quinone oxidoreductase subunit D

405 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.117 kDa

MMYEKTAEHFEQKYKNLPEGHLLVNLGPSHPATHGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNYVSTPLNNIGWILAVEKMMQIEVPDRVTYVRMIISELSRIIDHIICTGILGVDLGAFSGMLHLFHHRENIYQIIEKLTGARLTTTFCRIGGLEKDIYPDFVKEVKLVCKGLKPAIEEFNSLLLKNKIFLGRTEGIGGISAENAIAYGYTGPNLRAAGVDWDVRKDEPYLFYDKVDFDIPIGEDGSVLHRSLVRMEEMRQSIRIIEQLVDGIPSGPWHADLPHAYLPEKHKVYNNMEELIYHFKIIMHGVKVPPGEYYMATEAANGELGFYIVSEGEKSPWRVHVRRPCFWYYQSFAELVRGGLLADSVATMSSLNVIAGELDC

nuoD

NADH-quinone oxidoreductase subunit D

405 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.794 kDa

MMDGGKGFEDALTGEQKIRNFNINFGPQHPAAHGVLRMVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHAWCLAIEKLTGVEVPRRASLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARLHAAYFRPGGVHQDLPDALLDDIEAWSHTFPNVLDDIDGLLTENRIFKQRNCDIGVVSEEEILQYGFSGVMVRGSGLAWDLRRAQPYECYDEFEFQVPVGKNGDCYDRYLCRMEEMRQSISIIRQAIAKLRDCPGDVLARGKLTPPKRGDMKTSMESLIHHFKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADGTNKPYRSKIRAPGYLHLQAMDHVARGHQLADVAAIIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

405 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.702 kDa

MFEGYPVDTANTAGDQAVTNYTINFGPQHPAAHGVLRMVMELDGEIIERVDPHVGLLHRGTEKLIEYKTYLQALPYFDRLDYCSPLGMEHSYVLAIEKLLDLEVPARAQYLRTMFAELTRICNHMLNIGSHVMDVGAMTPNLWVFELREDCLNFFERASGARMHSAYFRPGGVHQDVPEKLLVDIGEWVETRLPKLFGDAMSLVIDNRIFKQRNVDIATVSKEDALAWGFSGPMIRGSGIAWDLRKSQPYDAYAAMEFDIPVGTRGDCYDRFMVRVEEVYQSAKIIKQCLRDMPTGPIASLDRKVVPPKRGEMKQSMESLIHHFKLYTEGFHVPAGEVYVATESPKGEFGVYLVSDGTNKPYRCKIRPTAFSHLQAMDMMSKGHMLADTTAIIGAIDVVFGECDR

nuoD

NADH-quinone oxidoreductase subunit D

404 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

46.056 kDa

MAMDTKFDDVLTGEQKLRNFNINFGPQHPAAHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHAWCLAIERLTGVAVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGARLHAAYFRPGGVHQDLTPRLIEDIEEWAEHFPKVLDDLDELLTENRIFKQRNVDIGIISEKDILDWGFSGVMVRGSGFAWDLRRSQPYECYDEFDFQIPVGKNGDCYDRYLCRMEEMRQSTRIIQQCLAKLRVEKGDVLARGKLTPPPRGEMKTSMEALIHHFKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADGTNRPYRAKIRAPGFLHLQAIDYIAKGHLLADVSAIIGTLDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

404 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.938 kDa

MYEKTAEHFEQKYKNLPEGHLLVNLGPSHPATHGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNYVSTPLNNIGWILAVEKMMQVEVPDRVTYVRMIISELSRIMDHIICLGILGVDLGAFSGMLHLFHHRENIYQIIEKLTGARLTTTFCRIGGLERDIYPEFEKEVKLVCKGLKPAIEEFNSLLLKNKIFLGRTEGIGGISAENAIAYGFSGPNLRAAGVDWDVRKDKPYMLYDKVDFDVPIGEDGSVLHRSLVRMEEMRQSIRIIEQLVDGIPSGAWHADLPHAYLPEKNKVYNNMEELIYHFKIIMHGVKVPPGEHYMATEAANGELGFYIVSEGEKSPWRVHVRRPCFWYYQSFAELVRGGLLADSVATMSSLNVIAGELDC

nuoD

NADH-quinone oxidoreductase subunit D

404 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.875 kDa

MMDGTNFDDALTGEQKIRNFNINFGPQHPAAHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHAWCLAIEKLTGTVVPRRGSLIRVLYCEIGRILNHLLNITTQAMDVGALTPPLWGFEEREKLMVFYERACGARLHAAYFRPGGVHQDLPPDLLDDIEAWSHEFPSVMDDIDGLLTENRIFKQRNCDIGVVTEEEILEWGYSGVMVRGSGLAWDLRRAQPYECYDEFDFQIPVGKNGDCYDRYLVRMQEMRESLKIIQQAIVKLRETKGDVLARGKLTPPSRADMKTSMEALIHHFKLYTEGFHVPAGEVYAAVEAPKGEFGVFLKSDGTNRPYRAKIRAPGYLHLQSMDHVAKGHQLADVAAIIGTMDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

403 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.626 kDa

MGKHIQYQGGNFKNTAPTKYQPTDLKVEEVLINIGPQHPATHGILRLEVILDGEIVVDVVPHLGYLHRCFEKHAATLPYNQTIPFVDRLDYLAAMNSEHAFAMGVEHMLGLTGKLPRRVEYIRVLMAELNRLASHFMAIGTYGIDLGAFTSFLWLMRDREYILRLFEWASGARMLYNYIWIGGLYYDLPVGFEERCLEFITYLKPKLEEINQLLIDNTLFIKRTANVGVLPLATAINHGVSGPILRASGLRLDLRRIDGYSIYPELSFDIPIGEGLMGHVGDCWDRTWVKFQECKESIKITEQCLVRLTSDLKRTADFNPQKMVPKKVRTKAQDCYIRAENPRGELGFFFRASDNGDKPIRCKARSSSFSNLSVISSIAKGQVLADLIAIIGSIDIVLGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

403 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.862 kDa

MSLSLEQSPTTGDEVITNYTINFGPQHPAAHGVLRMVMELDGEIIERIDPHVGLLHRGTEKLIEHKTYLQALPYFDRLDYCSPLGMEHSYVLAVEKLLNIEVPLRAQYLRVLFAELTRICNHMLNLGSHVMDVGAMTPNLWLFEIREDCLNFFERASGARMHSAWFRPGGVHQDVPLKLLTDMADWIDERLHPLFDDAMSLVVDNRIFKQRNVDIAVVSKEDALRWGFSGPMIRGSGIPWDLRKSQPYDVYDRMEFDIPVGTSGDCYDRFMVRVEEVRQSARIMKQCIEQMPDGPVASTDRKVVPPKRAEMKQSMEALIHHFKLYTEGFHVPAGEVYVATESPKGEFGVYLVSDGSNKPYRCKIRPTAFSHLQAMDFMCKGHMLPDATAILGAIDVVFGECDR

nuoD

NADH-quinone oxidoreductase subunit D

403 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.878 kDa

MTTEPLTPPTSGALLHTEIMSLNVGPQHPSTHGVLRLVVDMDGEYVTRVTPHMGYLHTGFEKTFEHRTYHQGVTYAPRTDYLHCFGHELAYVLSVEKLLGAEVPERATTVRVMLHELGRIHSHLVFVGTGLLDLGALTPFFYAFREKEAVQDLFEAVCGYRMNQGYFRVGGLARDIPEDWPARVAAFLDTFERGVDEYETLFAKNPIFLDRAKGVGVIPRDVAIDLGLTGPNLRASGVPLDHRKANPYCGYETYDFEVPVSQAGDSLARFQLRLLELRESAKIIRQALKRLTPGPIKDPNRKISLPPRSELETSMEAVIHHFKLVTEGFHPPKGEVYVPTESARGEVGYYIVSDGGSMPYRVKIRAPSFVNLQALEYACVGGQFADLITILASIDPVLGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

403 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.805 kDa

MDGSKFDDAQTGEQKIRNFNINFGPQHPAAHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHAWCLAIEKLTGVEVPRRAQLIRVLYSEIGRILNHLLNITTQAMDVGALTPPLWGFEEREKLMIFYERACGARLHAAYFRPGGVHQDLPDELLDDIDLWAMEFPKVMDDIDGLLTENRIFKQRNCDIGVVTEDDIQKYGFSGVMVRGSGLAWDLRRAQPYECYDEFDFQIPVGKNGDCYDRYLVRMEEMRQSLSIIRQAIAKLREATGDVLARGKLTPPKRGDMKTSMESLIHHFKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVADGSNKPYRAKLRAPGFLHLQAMDYVAKGHQLADVAAIIGTMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

403 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.65 kDa

MSVHIEESPTTDGDVITNYTINFGPQHPAAHGVLRMIMELDGEIIERVDPHVGLLHRGTEKLIEHKTYLQALPYFDRLDYCSPLCMEHSYVLAIEKLLNIEVPERAQYLRVLFAELTRISNHMLNLGAHVLDVGAFTPNLWMFELREDCMNFFERASGARMHMAWFRPGGVHQDVPEKLLVDIGEWLDTRLPELFGDAMSLVLDNRIFKQRNVDIAVVSKDDAVKWGFSGPMIRAAGIPWDLRKSQPYDVYDRMEFDIPVGTNSDCYDRFSVRVKEVYESAKIIKQCLAQMPQGPIASTDGKVSPPSRGRMKQSMEALIHHFKLYTEGFHVPAGEVYVATESPKGEFGVYLVADGTNKPYRCKIRPTAFSHLQAMDFMSKGHMLPDATAILGAIDVVFGECDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.219 kDa

MAHTLDSQQPAVPVRNFQINFGPQHPAAHGVLRMVLELNGEVVERVDPHIGLLHRGTEKLIEAKTYLQAVPYFDRLDYCAPMNQEHAFCLAVERLAGIEVPKRGQLIRVLYSEIGRLLSHLLNVTTFAMDVGALTPPLWGFEAREKLMMFYERASGSRMHAAYFRPGGVHQDLPQKLVEDIGEFCRTFPSLLDDLDALVTGNRIFKQRTVDIGVVTLEDALAWGFSGVMVRGSGAPWDLRRAQPYECYSELDFDIPIGKHGDCYDRYVVRMEEMRQSNKIMLQCVDRLLKEAGPVASTDRKVSPPKRGEMKRSMEALIHHFKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVGDGTNKPYRCKIRAPGFAHLQSMDFLCRGHMLADVSAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.474 kDa

MTKVSKERLKELEESGDVMELNLGPQHPSTHGVLRLKLRLEGEVVLSCDPVIGYLHTGVEKECESRTYHQVFTLVDRLDYLSGPAEEQAFAGALERLMNIEVPERAQTIRIILLELSRIASHLLWAGTSALELNMSSVFMYSFAEREKILDLFEQVSGARMFPSLWRIGGLAKDLNSDFISHLKEFISGFQKIWKELDRLLTDNFVWCKRLQGVAVIDQEICKQYMCTGPVLRASGISYDIRKAYPYLGYENYNFDIPTHIDGDSYARYLVRMEEMLQSISIIEQAIARLKPGVVLTNDRKVALPPRKELARSMEAVIHQFKLISEGLHPPVGSVYNCVESARGELGHYVISDGTPKPYRLRVRSPSFSHVEVLKKVLRGHVISDVVVAIASVDPILGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.401 kDa

MTEALGTVTPGMRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHAFCLAAERLLGIAVPRRGQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMMFYERASGSRMHAAYFRIGGVHQDLPPRLIDDIEAWCDPFLQVVADLDRLLTANRIFKQRNVDIGVVTLEQAWEWGFSGVMVRGSGAAWDLRKAQPYECYAEMDFDIPIGKNGDCYDRYLIRMEEMRQSVRIMKQCIAKLRAPDGQGPVAVEDNKIFPPRRGEMKRSMEALIHHFKLYTEGFHVPAGEIYAAVEAPKGEFGVYLVSDGSNKPYKCKIRAPGFAHLQAMDFICRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.192 kDa

MADAAAPDAASVRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHAFCLAVEKLLGIAVPRRAQLIRVLYAEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMMFYERASGSRMHAAYFRVGGVHQDLPPKLVDDIDAWCDAFPAVVNDLDRLLSDNRIFKQRNVDIGVVTLDQAWSWGFSGVMVRGSGAAWDLRKSQPYECYAELDFEVPIGKNGDCYDRYHIRMEEMRQSVRIMKQCIAKLRAPHGQGPVVVDDHKIFPPRRGEMKRSMEALIHHFKLYTEGFHVPAGEVYVAVEAPKGEFGVYLVSDGSNKPYKCKIRAPGFAHLQAMDFLSRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.17 kDa

MADAAAPDAASVRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHAFCLAVEKLLGIAVPRRAQLIRVLYAEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMMFYERASGSRMHAAYFRVGGVHQDLPPKLVDDIDAWCDAFPAVVNDLDRLLSDNRIFKQRNVDIGVVTLDQAWSWGFSGVMVRGSGAAWDLRKSQPYECYAELDFEVPIGKNGDCYDRYHIRMEEMRQSVRIMKQCIAKLRAPDGQGPVVVDDHKIFPPRRGEMKRSMEALIHHFKLYTEGFHVPAGEVYVAVEAPKGEFGVYLVSDGSNKPYKCKIRAPGFAHLQAMDFLSRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.854 kDa

MDTKFDDVLTGEQKLRNFNINFGPQHPAAHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDYVAPMNQEHAWCLAIERLTGVAVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGARLHAAYFRPGGVHQDLTPRLIEDIEEWAEHFPKVLDDLDELLTENRIFKQRNVDIGIISEKDILDWGFSGVMVRGSGFAWDLRRSQPYECYDEFDFQIPVGKNGDCYDRYLCRMEEMRQSTRIIQQCLAKLRVEKGDVLARGKLTPPPRGEMKTSMEALIHHFKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADGTNRPYRAKIRAPGFLHLQAIDYIAKGHLLADVSAIIGTLDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.819 kDa

MDTKFDDVLTGEQKLRNFNINFGPQHPAAHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMETRTYLQNLPYFDRLDYVAPMNQEHAWCLAIERLTGVQVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGARLHAAYFRPGGVHQDLTPRLIEDIEEWAEHFPKVLDDLDGLLTENRIFKQRNVDIGVVTEKDILDWGFSGVMVRGSGLAWDLRRSQPYECYDEFDFQIPVGKNGDCYDRYLCRMEEMRQSTRIIQQCLAKLRVEKGDVLARGKITPPPRAEMKTSMEALIHHFKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADGTNRPYRAKIRAPGFLHLQAIDYIAKGHLLADVSAIIGTLDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.211 kDa

MVDIADEMKPADKVRNFQINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEAKTYLQAVPYFDRLDYCAPMNQEHAFCLAAEKLLGIEVPKRGQLIRVLYSEIGRLLSHLLNVTTFAMDVGALTPPLWGFEEREKLMIFYERASGSRMHAAYFRPGGVHQDLPRALVEDIGAFCDPFLKLLDDLDGLVTENRIFKQRTVDIGVVSLEDALAWGFSGVMVRGSGAAWDLRRAQPYECYSELDFDIPIGKHGDCYDRYVVRMEEMRQSTKIMKQCVERLLKEAGPVSTTDNKIVPPKRGEMKRSMEALIHHFKLYTEGFHVPAGDVYAAVEAPKGEFGVYLVSDGTNKPYRCKIRAPGFAHLQAMDFLCRGHMLADVSAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.599 kDa

MADDMTQATEAPRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLLEHKTYLQGIGYFDRLDYVAPMNQEHAFCMAAEKLAGITVPKRGEYVRVLYCEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGSRMHAHYFRPGGVHQDLPMKLVEDIRAWCDQFPAKLDDIDSLLTENRIFKQRNVDIGVVTKEDVLAWGFSGVMVRGSGLAWDLRRSQPYSVYDELKFDIPVGKNGDCYDRYLCRMEEMRESVKIMIQCCDWLMKDENAGEVLATDSKFSPPRRAEMKRSMEALIQHFKLYTEGVHVEEGETYVAVEAPKGEFGVYLVSDGSNKPYRLKIRAPGFAHLAAMDYMSKGHMLADVSAIIGSLDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

401 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.383 kDa

MADAATEAAGLRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHAFCLAAEKLLGIEAPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMMFYERASGSRMHAAYFRIGGVHQDLPPKLIDDIDNWCDNFIQTVDDLETLLTDNRIFKQRNVDIGVVTLEQAWEWGFSGVMVRGSGAAWDLRKSQPYECYAEMDFDVPIGKNGDCYDRYCIRVEEMRQSVRIMKQCIAKMREPAGQGRVAVDDNKIFPPRRGEMKRSMESLIHHFKLYTEGFRVPAGEVYVAVEAPKGEFGVYLVSDGTNKPYKCKVRAPGFAHLQAMDFICRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

401 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.737 kDa

MTAELQPEAGALLHTELMSLNVGPQHPSTHGVLRLVVDMDGEYVTRVEPHMGYLHTGFEKTMEHRTYQQNVTYAPRTDYLHSFSHELAYVLSVEKLLGAEVPERANVVRVILHELGRIHSHLVFVGTGLLDLGALTPFFYAFREKEACQDLFEAVCGYRMNQGYFRVGGLARDLPEGWTARVEAFLNQMERGVEEYTTLFAANPIFLDRAKGVGVIPADAALDLGLTGPNLRASGVPLDNRKDHPYCGFEDYDFNVISSPDGDSLARFNMRLLEFSESIKIIRQGLQKLRPGPIKDPNRKISLPPRHELETSMEAVIHHFKLVTEGFHPPLGEAYVPIESARGEVGYYVISDGGSMPYRVKIRAPSFVNLQALEYACVGVQFADLITILATIDPVLGDVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.859 kDa

MQELDIAGVGSVRVTRKNDNVVVIEKDLATEQMILAMGPQHPSTHGVLKLECLTDGEVITEAEPYLGYLHRCFEKSCEHVDYPAIVPYTDRLDYLASMNSEQAYAMAVEKLLDIEIPRRVEFIRVIVAELNRIASHLVAIGTYGIDLGAFTPFLFCFRDREIILGLLEWASGARMLYNYIWIGGLAYDVPSDFFKRVGEFVTYFRPKAVELCNLLTENEIFVKRTRGIGIMPADVAINYGWSGPMLRGSGVKWDLRRNDPYSVYPELDFSVPVPDGKVSVVGDCLSRHLVRAYEMDESLKIIEQCIDKMPTAEGFNPRSAIPKRIRPKAGEVYARAENPRGELGFYIMSDGKSTKPLRCKARSSCFVNLSAMKDLSKGQLIPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 49 kDa subunit family.

45.173 kDa

MQELEQAVNRSVRVIPQGEGRVTIEKDLSSEEMILNMGPQHPSTHGVLRLECKTDGEVVTEAEPYLGYLHRCFEKHAEVVDYPGIVPFVDRMDYLAAMNSEFAYCIAVEKLLDVEIPRRVEFMRVIVSELNRIASHLVAIGTYAIDLGAFTPFLFCFRDREHIMSLLEWASGARMLYNYIWIGGASFDFPPGFKERTAEFVNYFRPKALELQRLLTENEIFVKRTKGIGMMPPDVAVNYGWSGPMLRGSGVEWDLRKHDPYSIYPELDFKVCVPDGKHSDIGDSLSRHLVRAYEMVESLSMIEQCLDKMPDANGFDPRSAIAKRIRPKAGEVYGRAENPRGELGFYIVSDGKSTKPVRCKARSSCFVNLSAMKELSMGQLIPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.792 kDa

MQELEKAVPSSVRVTRQSENLVILEKDLATEQMVLAMGPQHPSTHGVLKLECLTDGEVVTEAEPVLGYLHRCFEKTAENVDYPAVVPFTDRLDYLAAMNSEFAYALTVEKLLDIEIPRRVEFIRILVAELNRIASHLVAIGTYGIDLGAFTPFLFCFRDREIILGLLEWASGARMLYNYVWVGGLAYDVPADFLKRIREFCAYFRPKAKELADLLTSNEIFVKRTHGIGIMPADVAINYGWSGPMLRGSGVEWDLRRNDPYSLYSELDFNVCVPDGKHSVIGDCLSRHLVRAYEMEESLNIIEQCIDKMPSSDGFNSRAAIPKKIRPKAGEVYGRAENPRGELGFYIQSDGKSTKPLRCKARSSCFVNLSAMKDLSKGQLIPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.465 kDa

MQELGKVESNSIRVTRQDDKRITIEKDLDTEHMVLSMGPQHPSTHGVLRLECITDGEVIVEAEPYLGYLHRCFEKHCENVDYPGIVPYTDRMDYLAGMNSELAYCLTVEKLLDIEIPRRVEFIRVITSELNRIASHLVAIGTYAIDLGAFTPFLFCFRDREHIMNLLEWISGARMLYNYIWIGGLAYDVPADFKKRVAEFVTYFRPKAVELYKLLTENEIFVKRTKGIGIMPADVAINFAWSGPMLRGSGVKWDLRRNDPYSVYPELDFEVPVPDGKFSDVGDCLSRHLVRALEMEESLKIIEQCLDKMPEEQGFDPRALIPKKIRPKAGEVYGRAENPRGELGYYIVSDGKSTKPVRCKARSSCFVNLAAMKDLSKGQLLPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.342 kDa

MQELGKAEHTSIRVTPQGENRVIVEKDLSSEEMILNMGPQHPSTHGVLRLECKTDGEVVIEAEPYLGYLHRCFEKHAEMVDYPGIVPFVDRMDYLASMNNDFAYCIAVEKLLDIEIPRRVEFMRVIVSEINRIASHLVAIGTYAIDLGAFTPFLFCFRDREHMLNLLEWTSGARMLYNYILIGGVAYDFPKDFARRTLEFVKYFRPKALELQKLLTENEIFVKRTKGVGMMPADVAINYGWSGPMLRGSGVEWDLRRVDGYSVYPELDFKVCVPDGKFSDIGDSLSRHVVRALEIEESLNIIEQCLDKMPEEEGFDPRSAIPKRIRPKAGEVYGRAENPRGELGFYIISDGKSTKPLRCKARSSCFVNLSAMKELSLGQLIPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.014 kDa

MQELGITGQGSVRVTRKEGNVVVLEKDLATEQMVLAMGPQHPSTHGVLKLECFTDGEVVTHAEPYLGYLHRCFEKHCEVVDYPGIVPYTDRMDYLAGMNSEWAYCLAVEKLLDLELPRRVEFIRVIVSELNRIASHLVAIGTYAIDLGAFTPFLFCFRDREHILSLLEWASGARMLYNYIWIGGLAYDVPADFNKRVKEFVDYFRPKAVELYQLLTENEIFVKRTKGIGIMPADVAINYGWSGPMLRGSGVQWDLRRNDPYSVYPELDFKVPIPDGKFSDVGDCLSRHLVRALEMDESLSIIEQCIDKMPGSEGFNPRAAVPKRVRAKAGEVYCRAENPRGELGFYIQSDGKSTKPLRCKARSSCFVNLSAMKDLSKGQLIPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.966 kDa

MQELEMAGQGSLRLSRKSDTIVVLEKDLSTEQMVLSMGPQHPSTHGVLRLECLTDGEVVTEAEPYLGYLHRCFEKHCEHVDYPAIVPYTDRMDYLAGINSEMAYCVAVEKLLDLEIPRRVEFIRVIVSELNRIASHLVAIGTYAIDLGAFTPFLFCFRDREHILNMLEWATGARMLYNYIWVGGLAYDVPAGFNERVLEFVNYFRPKALELQQLLTENEIFVKRTKGIGIMPADVAINYGWSGPMLRGSGVQWDIRRNDPYSIYPELDFAVPVPDGKLSVVGDCLSRHLVRALEIEESLKIIEQCIDKMPGTQGFDPRSAVPKRVRPKAGEVYGRAENPRGELGFYIQSDGKSTSPLRCKARSSCFVNLSAMKDLSRGQLIPDLVAIIGSLDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.518 kDa

MQELGKAETNSTRIIRQDDKRVTIEKDLDTEHMVLSMGPQHPSTHGVLRLECITDGEVVVEAEPYLGYLHRCFEKHCEKIDYPAIVPYTDRMDYLAGMNNELAYCITVEKLLDIEIPRRVEFIRVIVAELNRIASHLVAIGTYAIDLGAFTPFLFCFRDREHIMSLLEWISGARMLYNYIWIGGLAYDVPADFKTRVAEFVTYFRPKAKELYQLLTENEIFVKRTYDIGIMPADVAINYGWSGPMLRGSGVKWDLRRNDPYSVYPELDFDVPVPDGKFSVVGDCLSRHLVRALEMEESLKIIEQCLDKMPEEPNFNSRALIPKKIRPKAGEVYGRAENPRGELGYYIVSDGKSTSPVRCKARSSCFVNLSAMKDLSKGQLIPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

400 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.223 kDa

MSETVQKQGRVVEIDSHAINFGPQHPAAHGVLRLVLELDGEVVERADPHIGLLHRGTEKLIEYKSYLQALPYFDRLDYVSPMCEEHAFALATEKLLGITAPERAQWIRTMFAEITRILNHLLNLTTYALDGGAMTPVLWGHEEREKLLEFHEAVSGARFHANYFRPGGVAKDLPAGLTDRIADWTEKFPAFIDDMAGLLSDNRIWKQRVVDIGRMTPEQALAWGFSGPCIRASGIPWDLRKSQPYDKYADVDFEVPVGRNGDCYDRYLVRVEEMRQSVRIVKQCLGKIRPGPIKVQDHKITPPPRAEMKRSMEALIHHFKLYTEGYHVPEGATYTAVESPKGEFGVYLVSDGSNRPYRCKIRPTGFAHLQAIDVMAHRHMLADAVVIIGSLDLVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

398 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.004 kDa

MLPMSDTRSSRIKPMTLNFGPQHPAAHGVMRLILEMSGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMSQEHAYSLCVEKLLQCVVPPRAKYIRVIFCELTRVLNHLLNVSSQALDTGATTPLLWMFEERERLLSFYERASGARFHAAYIRPGGIAADVPDGLLDDIHAFTESFPKLLDDVDGLLTENSIWKQRNVDIGVVSKAQALDWGFSGPMLRACGIPWDLRKSQPYEIYETLDFKVPVGSNGDCYDRYLVRMAEMRESISIIRQCLNGIPEGPVKTDDRKIAPPRREELKYSMEALIHHFKLFSEGYKVPEGEAYVAVEAPKGEFGVYIVSDGTNRPYRCRIRAPGFAHLQAIDAMARGHMLADLTAIIGSLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

398 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.058 kDa

MNEQPENLRNFTINFGPQHPAAHGVLRLVLELDGEIVARVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHAFCLAAEKLLGIEVPRRGQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGSRMHAAFFRVGGVHQDLPQKLVDDIEAWCDPFLKVVDDLDRLLTANRIFKQRNVDIGVVPLKEAWEWGFSGVMVRGSGAAWDLRKSQPYECYAEMDFDIPIGKNGDCYDRYLIRMEEMRQSVRIMRQCIQKLNAPEGKGPVVVEDNKVAPPRRGEMKRSMEALIHHFKLYTEGVHVPAGEVYAAVEAPKGEFGVYLVADGTNKPYKCKIRAPGFAHLQAMDHICRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

398 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.978 kDa

MNEQSPALRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIETKTYLQAMPYFDRLDYVAPMNQEHAFCLAAERLLGIEVPRRGQLIRVLYSEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGSRMHANYFRIGGVHQDLPPKLIDDIDAFCDPFLKVVDDLDQLLTGNRIFKQRNVDIGVVTLKQAWEWGFSGVMVRGSGAAWDLRKSQPYDVYAEMEFDVPIGKNGDCYDRYLIRMEEMRQSVRIMKQCIQKLRAPDGQGPVVVTDNKIAPPRRGEMKRSMEALIHHFKLYTEGVHVPAGEIYAAVEAPKGEFGVYLVSDGSNKPYKCKIRAPGFAHLQAMDFLCRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

398 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.947 kDa

MNEQSPALRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIETKTYLQAMPYFDRLDYVAPMNQEHAFCLAAERLLGIEVPRRGQLIRVLYSEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGSRMHANYFRIGGVHQDLPPKLVDDIDAFCDPFLKVVDDLDQLLTGNRIFKQRNVDIGVVTLKQAWEWGFSGVMVRGSGAAWDLRKSQPYDVYAEMEFDIPIGKNGDCYDRYLIRMEEMRQSVRIMKQCIAKLRAPDGQGPVLITDNKIAPPRRGEMKRSMEALIHHFKLYTEGVHVPAGEIYAAVEAPKGEFGVYLVADGTNKPYKCKIRAPGFAHLQAMDFLCRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

398 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.113 kDa

MGNNVAETQIKPFTMNFGPQHPAAHGVLRLVLEMDGEVVQRADPHVGLLHRGTEKLIEYKTYIQALPYFDRLDYVSPMSQEHAFALATEKLLGITVPVRGQYIRVLFSEITRILNHLLNITTFGLDVGAITPSLWGFEEREKLMAFYERVSGARMHANYFRPGGVNLDMPAGLADDIWEYTERFPKFVADLNNLLTENRIFKQRTVDIGVVSRADALAWGFSGPMIRGSGVPWDLRKAQPYDRYDEFDFDIPVGSTGDCYARYLVRMEEMRQSNRLIRQALEKLAKTPGPVKVNDRKIAPPPRGEMKRSMESLIHHFKLYTEGYHVPAGETYTAVESPKGEFGVYLVSDGTNRPYRCKIRPTGFSHLQAMDFMSKGHMLADTVAIIGSMDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

398 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.265 kDa

MVPAIPETPVRKFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLMEARTYLQNIPYFDRLDYVAPMNQEHAFCLAIEKLLGVEVPIRGQIIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARLHSNYFRPGGVHQDLPPELVEDIDTWAKAFPKICDDIEGLITDNRIFKQRNVDIGVVSKEEAISWGFSGVMVRGSGIAWDLRRSQPYENYNDFEFDIPLGKNGDCYDRYLCRMQEMRESTKIIRQACEMLRKTHGPVLSEDNKVAPPRRAEMKRSMEALIHHFKLYTEGFKTPAGEVYACVEAPKGEFGVFVVSDGTNKPYRCKIRAPGFPHLAAMDWMNRGHQLADVSAILGSLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

397 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.486 kDa

MPATITDHKEFQNYAINFGPQHPAAHGVLRLLLELDGEVVERADPHVGLLHRGTEKLLEQKTYIQGTPYFDRLDYMSMMSEEHAWVIAVERLGQIEVPERAQYIRTIYAEITRFINHLLFFAAHGLDVGAMTMFLYCFREREELMDIYEAACGARMHANYFRPGGVARDLPDGLEQRIRDFCNHFPSKLDEYETLLTNNRIWKQRLVDIGKVSQEDAFSWGFTGPMLRGSGVAFDLRKAEPYDAYDRVEFDIPVGKNGDSYDRYLVRIEECREGVKIIQQCLDQMQPGPVRNDNFKISMPYRQDMQQDMESMIHHFKLCTEGFNLPAGEVYAAVETPKGELGVYLVSDGGNKPYRARIRAAGFNHLQAVKEMARGHMIADVTTIIGSIDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.649 kDa

MTEHNVRNFTINFGPEHPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDYVAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGAMTPPVWGFEEREKLMVFYERACGARMHSAYVRPGGVHQDLPPELVDDIGKWCDPFLTVLDNIEGLLTDNRIYKQRNVDIGVVSLEDAFAWGFTGVMVRGSGAAWDLRRSQPYECYSDLEFDIPVGKNGDCYDRYLIRMQEMRESVKIMKQCVDRLSGKHRIGPVSSLDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADGSNKPYRCKIRAPGYAHLQAMDFLCKGHQLADVTAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.729 kDa

MAEVNVRNFNINFGPQHPAAHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDYVAPMNQEHAFVLAVEKLLGVEVPKRGQLIRVLFSEIGRLLNHLLNVTTQAMDVGALTPPLWGFEQREKLMIFYERACGARLHANYFRPGGVHQDLPEVLIEDIGNFIDPFLVALGNLDALITPNRIFKQRNVDIGVVSIDEAWARGFSGVMIRGAGVPWDLRKSQPYECYDEMEFDIPVGKNSDCYDRYLIRMEEMRQSAKIMRQCVDRLLSTEKDGPVSSLDRKIVPPKRSEMKNSMEALIHHFKLYTEGFHTPPGEVYVAVEAPKGEFGVYLVSDGTNKPYRVKLRAPGFAHLQAMDFLTRGHMLADATAILGSIDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.852 kDa

MAEVNVRNFNINFGPQHPAAHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDYVAPMNQEHAFVLAIEKLLGVEVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGALTPPLWGFEQRERLMIFYERACGARLHANYFRPGGVHQDLPESLVEDIGNFIDPFLIALGKLDALITPNRIFKQRNVDIGVVSIDEAWARGFSGVMIRGAGVPWDLRKSQPYECYDEMEFDIPVGKNSDCYDRYLIRMEEMRQSAKIMRQCVDRLLSTEKNEPVSSLDRKIVPPKRCEMKSSMEALIHHFKLYTEGFRTPPGEVYVAVEAPKGEFGVYLVSDGTNKPYRVKLRAPGFAHLQAMDFLTRGHMLADATAILGSIDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.909 kDa

MAEVNVRNFNINFGPQHPAAHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAVPYLDRLDYVAPMNQEHAFVLAIEKLLGVEVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGALTPPLWGFEQRERLMIFYERACGARLHANYFRPGGVHQDLPESLIEDIGHFIDPFLISLSRLDALVTPNRIFKQRNVDIGVISIDEAWVRGFSGVMIRGAGVPWDLRKSQPYECYDEMEFDIPVGKNSDCYDRYLIRMEEMRQSARIMRQCVDRLLGSEKNGPVSSLNRKVVPPKRSEMKSSMEALIHHFKLYTEGFHTPPGEVYVAVEAPKGEFGVYLISDGTNKPYRVKLRAPGFAHLQAMDFLTRGHMLADATAILGSIDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.75 kDa

MTEHNVRNFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDYVAPMNQEHAYAMAVEKLLGIEIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGSRMHAAYFRPGGVHQDLPEQLVQDIGAWCDPFLKALDDIDNLLTGNRIFKQRNVDIGVVSLDECWAWGFSGVMVRGSGAAWDLRRAQPYECYSDLEFDIPIGKNGDNYDRYLIRMIEMRESVRIMKQCVNRLLSDAKTGPFSSIDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGTNKPYRCKIRAPGYAHLQAMDFMCRGHQLADVAAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.506 kDa

MAETSVRNFNINFGPQHPAAHGVLRLVLELDGEVVDRVDPHIGLLHRGTEKLIEAKTYLQAVPYLDRLDYCAPMNQEHAFALAAERLLGIEVPKRGQLIRVLYCEIGRIMSHILNVTTQAMDVGALTPPLWGFVEREKLMVFYERASGSRMHAAYFRPGGVHQDLPRQLVEDIGKWIDPFLKSIDDLDRLLTGNRIFKQRNVDIGIVSLADAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMDFDIPIGKNGDCYDRYLVRMEEMRQSARIMRQCVDLLLGKESTGPVSNLDGKVVPPKRAAMKRSMEALIHHFKLYTEGYRVPAGEVYAAVEAPKGEFGVYLVSDGTNKPYRCKLRAPGFAHLQAMDFLCRGHLLADVTAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.729 kDa

MTEHNVRNFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDYVAPMNQEHAYALAVEKLLGIEIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGSRMHAAYVRPGGVHQDLPEQLVQDIGDWCDPFLKALDDIDNLLTGNRIFKQRNVDIGVVSLEDCWAWGFSGVMVRGSGAAWDLRRSQPYECYSDLEFDIPIGKNGDNYDRYLIRMIEMRQSVRIMKQCVNRLLSDAKTGPFSSIDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRCKIRAPGYAHLQAMDFMCRGHQLADVAAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.882 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQALPYLDRLDYVAPMNQEHAYALAVERLLGIDVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLVEDIGKWIDPFFNTLNNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYNEMEFDIPIGKNGDCYDRYLIRMEEMRQSARIMRQCVDLLLGKERVGPVSNADNKIVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVFLVSDGSNKPYRCKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.265 kDa

MALKKRSKHSKKFKLNLGPQHPATHGVLRLILEMDGEIVERADPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDYVSPMCQEHAFALAIEHLLKCEVPLRAQYIRVMFSELTRILNHTLNIATQALDVGATTPLLWMFEEREKIMEFYERVSGSRLHANYFRPGGVAQDLPEGLIENIVDFCEQFPCKIADLETLLTDNRIWKQRTVDIGIVSKQQAMDWGFSGVMLRGSGIAWDLRKSQPYDQYANLDFDVAIGKNGDCYDRYLIRIEEMYQSIKIIKQCIQKMPVGEIKTQDPSISPPKRSEIKKSMEALINHFKLYSEGYNVPAGEVYAAVEAPKGEFGVYLYSDGTNRPYRCRIKAPGFAHLQGLDFMARGHSLSDIITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.253 kDa

MALKKRSKHSKKFKLNLGPQHPATHGVLRLILEMDGEIVERADPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDYVSPMCQEHAFALAIEHLLKCEVPLRAQYIRVMFSELTRILNHTLNIATQALDVGATTPLLWMFEEREKIMEFYERVSGSRLHANYFRPGGVSQDLPEGLIENIADFCEQFPCKIADLETLLTDNRIWKQRTVDIGIVSKQQAMDWGFSGVMLRGSGIAWDLRKSQPYDQYANLDFDVAIGKNGDCYDRYLIRIEEMYQSIKIIKQCIQKMPAGEIRTQDPSISPPKRSEIKKSMEALINHFKLYSEGYNVPAGEVYAAVEAPKGEFGVYLYSDGTNRPYRCRIKAPGFAHLQGLDFMARGHSLSDIITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.887 kDa

MAEVNVRNFNINFGPQHPAAHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDYVAPMNQEHAFVLAIEKLLNIKVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGALTPPLWGFEQRERLMIFYERACGARLHANYFRPGGVHQDLPESLVEDIGNFIDPFLVSLEKLDALVTPNRIFKQRNVDIGIVSIDEAWARSFSGVMIRGAGVPWDLRKSQPYECYDEMEFDIPIGKNSDCYDRYLIRMEEMRQSAKIMRQCVERLLGAEKNGPVSSLDRKIVPPKRSEMKSSMEALIHHFKLYTEGFHTPPGEVYVAVEAPKGEFGVYLVSDGTNKPYRVKLRAPGFAHLQAMDFLTRGHMLADATAILGSIDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.027 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLIEDIGKWIDPFFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMEFDIPVGKNGDCYDRYLIRMEEMRQSARIMRQCVDLLLGKERVGPVSNTDHKIVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRFKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.027 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLIEDIGKWIDPFFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMEFDIPVGKNGDCYDRYLIRMEEMRQSARIMRQCVDLLLGKERVGPVSNTDHKIVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRFKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.027 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLIEDIGKWIDPFFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMEFDIPVGKNGDCYDRYLIRMEEMRQSARIMRQCVDLLLGKERVGPVSNTDHKIVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRFKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.983 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLIEDIGKWIDPFFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMEFDIPVGKNGDCYDRYLIRMEEMRQSARIMRQCVDLLLGKERVGPVSNTDHKIVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRCKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.011 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLIEDIGKWIDPFFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMEFDIPVGKNGDCYDRYLIRMEEMRQSVRIMRQCVDLLLGKERVGPVSNTDHKIVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRCKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.983 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLIEDIGKWIDPFFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMEFDIPVGKNGDCYDRYLIRMEEMRQSARIMRQCVDLLLGKERVGPVSNTDHKIVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRCKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.983 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLIEDIGKWIDPFFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMEFDIPVGKNGDCYDRYLIRMEEMRQSARIMRQCVDLLLGKERVGPVSNTDHKIVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRCKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.93 kDa

MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDYVAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERACGARMHAAYFRPGGVHQDLPDQLIEDIGKWIDPFFTTLKNLDDLITPNRIFKQRNVDIGVVKLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYSEMEFDIPVGKNGDCYDRYLIRMEEMRQSARIMRQCVDLLLGKERVGPVSNTDHKIVPPKRGEMKCSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGSNKPYRCKLRAPGFAHLQAMDFLCRGHMLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.674 kDa

MPEGALRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHAFCLAAEKLLGIAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMVFYERASGSRMHAAYFRIGGVHQDLPPQLIEDIETWCDAFPQVVDDLDRLLTGNRIFKQRNVDIGVVTLPQAWEWGFSGVMVRGSGAAWDLRKSQPYECYAEMDFDVPIGKNGDCYDRYLLRMEEMRQSVSIMKQCIAKLRAPDGQGPVALEDHKIVPPRRGEMKRSMEALIHHFKLYTEGFRVPAGEVYVAVEAPKGEFGVFLVSDGTNKPYKCKIRAPGFAHLQAMDFVTRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.631 kDa

MPEGALRNFTINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEAKTYLQAIPYFDRLDYVAPMNQEHAFCLAAEKLLDIAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMMFYERASGSRMHAAYFRVGGVHQDLPPKLVDDIEAWCVAFPQVIDDLDRLLTGNRIFKQRNVDIGVVTLAQAWEWGFSGVMVRGSGAAWDLRKSQPYECYAELEFDIPIGKNGDCYDRYCIRMEEMRQSVRIMQQCIAKLRAPDGGGPVAVQDNKIFPPRRGEMKRSMESLIHHFKLYTEGFRVPAGEVYVAVEAPKGEFGVFLVSDGSNKPYKCKIRAPGFAHLQAMDFISRGHLLADVSAILGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.967 kDa

MTEHNIRNFAINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQATPYFDRLDYVSPMNQEHAFCLAIEKLAGIEVPRRAQLIRVLFCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLMIFYERASGARLHANYFRPGGVHQDLPPKLIDDIDAFCDPFLQVVQDLDDLVMANRIFKQRNVDIGIVSVDEAMQWGFSGVMVRGSGIPWDLRKAQPYECYEEMEFDVPVGKNGDTYDRQVIRMEEMRQSVRIMKQCVAKLREPAGQGPIASVDGKFAPPPRREMKRSMEALIHHFKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVSDGTNKPYRCKIRAPGFAHLQAMDWMCRGHLLADVSCVLGTLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.642 kDa

MTEHSIRNFSINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEVKTYLQATPYFDRLDYVAPMNQEHAFCLAVEKLLGIEVPRRAKLIRTLFCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLMIFYERASGARLHANYFRPGGVHQDLPPGLIDDIEAFCDPFLQVVDDLDALVIGNRIFKQRNVDIGIVTVDAAMAWGFSGVMLRGSGIPWDLRRAQPYEAYEEMEFDVPVGKNGDTYDRQVIRMEEMRQSVRIMKQCLAKLRAPDGQGPVTTQDGKVAPPSRREMKRSMEALIHHFKLYTEGFHVPAGEVYAAVEAPKGEFGVYLVADGTNKPYRCKIRAPGFAHLQAMDWMCRGHMLADVSCILGTLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.906 kDa

MAETSIRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDYVAPMNQEHAFALAIERLLGIDVPIRGQLIRVLYSEISRILNHLLNITTQAMDVGALTPPLWGFEEREKLMVFYERASGARMHAAYFRPGGVHQDLPEKLVEDIGKWIDPFLKTVDDLDELLTENRIFKQRNADIGIVSLEDAWAWGFSGVMVRGSGAAWDLRKSQPYECYPEMDFDIPVGKNGDCYDRYLIRMEEMRQSAKIMRQCVERLLGKERVGPVSNMDGKVVPPKRAAMKRSMESLIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVADGTNKPYRCKLRAPGFAHLQAMDFMCRGHLLADVTAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.912 kDa

MTEHNIRNFSINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQATPYFDRLDYVAPMNQEHAFCLAIERLAGIEVPRRAQLIRTLFCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLMIFYERASGARLHANYFRPGGVHQDLPPALIDDIEAFCDPFLKVVDDLDNLVMANRIFKQRNVDIGIVSVDEAMAWGFSGVMVRGSGIPWDLRKSQPYELYEEMEFDIPVGKNGDTYDRQVIRMEEMRESVKIMRQCVAKLREPAGQGPIASIDGKFAPPPRREMKRSMEALIHHFKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVSDGTNKPYRCKIRAPGFAHLQAMDWMCRGHLLADVSCVLGTLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.91 kDa

MSEHNIRNFSINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQATPYFDRLDYVSPMNQEHAFCLAIERLAGIEVPRRAQLIRTLFCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLMIFYERASGARLHANYFRPGGVHQDLPPALIDDIEAFCDPFLKVVDDLDNLVMANRIFKQRNVDIGIVSVDEAMAWGFSGVMVRGSGIPWDLRKSQPYECYEEMDFDIPVGKNGDTYDRQVIRMEEMRESVKIMRQCCAKLREPSGQGPIASIDGKFAPPPRREMKRSMEALIHHFKLYTEGFHVPEGEVYAAVEAPKGEFGVYLVSDGTNKPYRCKIRAPGFAHLQAMDWMCRGHLLADVSCVLGTLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.264 kDa

MLREERRAAEEAITLIRPATSRLVDPDIRDEFGLETLDMNMGPQHPAMHGLLRLILELDGETIVRCDPVMGYLHRCQEKIAENRTYPAVIPLTDRLDYFANMHNEHGYCLAVEDLLGVEIPPRAEYIRVLMCELMRIASHLPSIGFLLLELGAFTPILYAFRERERIQNFFEAVTGARMMFHYIRIGGVKADLPPDIPEKIWEYVEGLEKRIKPDFIDLIEGNEIFIERTRGISRLTQEEAIELGLTGPPLRCTGVAFDVRRDYPYSVYPELDFEVVTDTAGDVEASYRVRIKEVYESIKIIRQCLEKMPEGEVMGDVGRRVRPPEGEGFGRVEGPRGEFAVHVVSDGSDTPYRVHYRDPSFVNMQLLQEKMPGHYLPDIMPIMGLVDPVSGGWDK

nuoD

NADH-quinone oxidoreductase subunit D

395 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.822 kDa

MSDSSDGYAKPMTINFGPQHPAAHGVMRLILEMSGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMSQEHAYSLCVERLLGCEVPIRAKYLRVIFCELTRLLNHLLNVACQALDSGATTPLLWIFEEREKILSFYERASGARFHSAYIRPGGLAADVPDGLLDDIHEFTNYFPKLLDSVDDLLTENSIWKQRNVEIGKVTKQQALDWGFSGPMLRACGIPWDLRKSQPYEIYDILDFKVPVGSNGDCYDRYLVRMAEIRESLYILEQCLRDIPSGPVKTDDRKIAPPKREELKYSMEALIHHFKLFSEGYKVPEGEAYAAVEAPKGEFGVYIVSDGTNKPYRCRIRSPGFAHLQAIDAMARGHMLADLPVIIGSLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

395 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.617 kDa

MAEQGSIRVSRKDDNVVVIEKDLATEEMLLSMGPQHPSTHGVLKLECMTDGEVVTSAEPYLGYLHRCFEKHCEVVDYPGIVPYTDRMDYLAGMNNEWAYCIAVEKLLDIEIPRRVEFIRVMVSELNRIASHLVAIGTYGIDLGAFTPFLFCFRDREHILNLLEWASGARMLYNYIWIGGVAFDIPADFNKRVKEFVDYFRPKVVELYKLLTENEIFVKRTKGIGIMPADVAINYAWSGPMLRGSGVQWDLRRNDPYSVYPELDFNIPVPDGKFSDIGDCLSRHLVRALEMEESLNIIEQCISKMPGSDGFNPRSAVPKRVRPKAGEVYARAENPRGELGFYIQSDGKSTKPLRCKARSSCFVNLSAMKDLSKGQLIPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

395 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.402 kDa

MAGQGSVRLTRKSDNVVIIEKDLATEEMVLSMGPQHPSTHGVLRLECRTDGEVVTEAEPYLGYLHRCFEKYCENVDYPAIVPYTDRMDYLAGMNSEMAYAIAVEKLLDIEIPRRVEFIRVIVSELNRIASHLVAIGTYAIDLGAFTPFLFCFRDREHILNMLEWASGARMLYNYIWIGGLAYDVPADFQKRVGEFVDYFRPKALELSRLLTENEIFVKRTKGIGIMPADVAINYGWSGPMLRGSGVQWDLRRNDPYSIYPELDFAVPVPDGKFSDVGDCLSRHLVRALEIEESLKIIEQCIEKMPSAEGFDPRAAVPKRIRPKAGEVYARAENPRGELGFYILSDGKSTSPVRCKARSSCFVNLSAMKDLSKGQLIPDLVAIIGSIDIVLGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

393 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.78 kDa

MSDQVKITPMTLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMAQEHAYSLCVEKLLKCEIPIRAKYLRVIFCELTRILNHLLNISSQALDIGAMTPLLWMFEEREKILGFYERASGARFHSAYIRPGGVAADVPSDLIDDIFKFVSTFSKFMDDIDDLLTENRIWKQRNVDIGVVSKKQALDWGFSGPMLRACGIPWDLRKSQPYEIYEDLEFEIPVGENGDCYDRYLVRMAEIRQSIKLLEQCLDRLPDGPVKTDDRKIAPPKRSEMKESMEALIHHFKLYSEGYSVPVGETYMAVEAPKGEFGVYIVSDGTNKPYRCRIRAPGFAHLQAIDIIAKGHMLADLTAIIGSLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

393 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.019 kDa

MSDRVKITPMTLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMCQEHAYSLCVEKLLKCEIPIRAKYLRVIFCELTRILNHLLNISSQALDIGAMTPLLWMFEEREKILGFYERASGARFHSAYIRPGGVAADVPDDLIDDIFKFIKTFPKFIDDVDELLTENRIWKQRNVDIGIVSKEQALDWGFSGPMLRACGIPWDLRKSQPYEIYEDLEFEIPIGKKGDCYDRYLVRMAEIRQSIKLLEQCLNRLPNGPIKTDDRKIAPPKRSEMKESMEALIHHFKLYSEGYSVPIGETYMAVEAPKGEFGVYIVSDGTNKPYRCRIRAPGFAHLQAIDMMAKGHMLADLTAIIGSLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

393 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.909 kDa

MSDHVKITPMTLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMAQEHAYSLCVEKLLKCEVPIRAKYLRVIFCELTRILNHLLNISSQALDIGAMTPLLWMFEEREKILNFYERASGARFHSAYIRPGGVAADIPEDLIHDIFQFVNTFPKFMDDVDSLLTENRIWKQRNVDIGVVSKKQALNWGFSGPMLRACGIPWDLRKSQPYEIYDELEFKIPIGEKGDCYDRYLVRMAEIRESISLVEQCLNRIPDGPVKTDDRKIAPPKRSEMKKSMEALIHHFKLYSEGYIVPAGETYMAVEAPKGEFGVYIVSDGTNKPYRCRIRAPGFAHLQAIDMMAKGHMLADLTAIIGSLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

393 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.952 kDa

MSDHVKITPMTLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSPMAQEHAYSLCVEKLLKCEVPIRAKYLRVIFCELTRILNHLLNISSQALDIGAMTPLLWMFEEREKILNFYERASGARFHSAYIRPGGVAADIPEDLIHDIFQFVNTFPKFMDDVDSLLTENRIWKQRNVDIGVVSKKQALNWGFSGPMLRACGIPWDLRKSQPYEIYDELEFKIPIGEKGDCYDRYLVRMAEIRESIRLVEQCLNRIPDGPVKTDDRKIAPPKRSEMKKSMEALIHHFKLYSEGYSVPAGETYMAVEAPKGEFGVYIVSDGTNKPYRCRIRAPGFAHLQAIDMMAKGHMLADLTAIIGSLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

392 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.488 kDa

MAEQELRNYHLNFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQATPYFDRLDYVAPMNQEHAFVLAAERLLGLEVPRRAQFIRVLYSEIGRILAHLLNVTTQAMDVGALTPPLWGFEEREKLMIFYERASGARLHANYFRTGGVHRDLPPKLLEDIYNFCDPCSQVLDDLEGLITDNRIFKQRNVDIGVVSQEEALEWGFSGVMVRGSGMAWDLRRAQPYEVYSELDFDIPVGKNGDCYDRYLCRMEEMRQSLRIMKQCIELMPGGPVHVLDGKVVPPSRSEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYLVSDGGNKPYKCKIRAPGYAHLQAMDHLCKGHMLADVSAILGSIDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

392 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.279 kDa

MAQTEIKSYTLNFGPQHPAAHGVLRLVLELSGEVIERADPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYACPMNQEHAYVLAVEKLLGITVPPRAQYLRTLFNEVTRLINHIMNTTSMALDIGAMTPLLYGFEEREHLLEFSERASGARMHAAWFRPGGVARDVPPDLLEDILKFCDSFPKYLDDVEHLLDENRIFKQRTVDIGKVTAQQALDWGFTGPVLRGCGVPWDLRKSQPYDAYAAMDFDIPTGANGDCYDRYLVRMAEQRQSIRIMRQCIEKMPDGPVKAVDHKVTPPSRGEMKSSMEALIHHFKLFTEGFKVPEGETYTAVEAATGEFGVYLVSDGTNRPYRCKIRSPGYVHLQGLDLMSRGHMLADVVANIGSIDVVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

392 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.097 kDa

MAESQIQSYTINFGPQHPAAHGVLRLILEMSGEVVDRADPHVGLLHRGTEKLIEHKTYLQATPYFDRLDYVGTMNQEHAFVLATEKLLGIDIPIRAKFIRTLYDEIGRILNHLLNVTAFIFDVGGMTPLLYGFEEREKLMEFYERVCGARLHANYYRPGGVAADLPAGLLEDIAAWCETFPKVLDDIETLATDNRIFKQRVVDIGVVSPEQALDWGFTGPNLRASGIAWDLRKSQPYDVYDQMEFDIPVGKNGDGYDRYLVRVLEMRESVKIMKQCIAKMPGGPVRVEDNKITPPKRSEMKTSMESLIHHFKLFTEGFKVPAGEVYGAIEAPKGEFAVYLVSDGTGKPYRCKIRPPGYVHLQALDMMSKGHMLADVVANIGSIDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

392 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.455 kDa

MDDRKFTLNFGPQHPAAHGVLRMILDLDGEIVTRVDSHIGLLHRGTEKLLEYKTYLQGMPYFDRLDYCAPMNQEHAWCLAIEKLLGVEVPRRASIIRVMYSEIGRIMSHLLNVGTGVMDVGALTPITWCFEEREKLCVFYERASGSRMHAAYFRPGGVHQDLPQRLIDDIATWCDQFPGKLDQIEGLVTENRIFKQRNVDIGVVDQRTILDWGFSGVMVRGSGLAWDLRRSQPYECYSELDFKVPVGRHGDNYDRYVCRMDEMRESVKIILQCIDLMAKDGPGPVLLAGSKLSPPRRADMKNSMEALIHHFKLYTEGFHVPEGECYAAVEAPKGEFGVYLVADGTNRPYRAKIRAPGYPHLQAMDYLCKGHQLADVSAVLGTLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.224 kDa

MTKKIKTLNLNFGPQHPAAHGVLRLILELDGEVVEKADPHIGLLHRGTEKLIENKTYMQAVPYFDRLDYVAPMNQEHAFALAIEKILKINVPIRAQLIRVMFCEIGRILSHILNVTTQALDVGALTPSLWGFEERETLMTFYERASGSRLHANYFRAGGVHQDLPMGLAEDIGNFCESFPKIIDDLETLLTDNRIFKQRNVDIGIVTKEDALDYSFSGVMIRGSGVPWDLRKSQPYDCYEQLEFKIPVGKNGDCFDRYLCRIEEMRESVSIIKQCLSKMEKGPIKSLDGKISPPPKKDIKQSMEALIHHFKLFTEGYRVDKDEIYTAVEAPKGEFGVYLISDGTSKPYKCKIRAPGFSHLQAMDYLIKGHMLADVPAVLGSLDIVFGEVDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.647 kDa

MTNNTKTITLNLGPQHPATHGVLRLILEMDGEIVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAVESLLECEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGATTPLLWLFEEREKIMEFYERVSGSRMHSNYFRPGGVAEDLPDGLLEDIDKFIDQFPPKLHDIESLLNENRLWKQRLVDIGVVSQKEAMDWGFSGPMLRGSGIAWDLRKSNPYDVYDEMEFEVPIGKNGDCYDRYFVRMLEMYESIKIIKQCIEKMPKGAVKTNDPKLTPPTRAKMKESMEAMIHHFKLYTAGYDVPAGETYKAVEAPKGEFGVYLYSQGVNIPYRCRIKSPGFAHLQGLDFMSKGHLMADVITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.571 kDa

MTNNTKSITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAAESLLECEIPRRAQFIRVLFSELTRILNHTLNIGSQALDVGATTPLLWLFEEREKIMEFYERVSGSRMHSNYFRPGGVAEDLPDGLLEDIDKFIQQFPPKLQDIENLLNENRLWKQRLVDIGVVSQKEAMDWGFSGPMLRGSGIAWDLRKSNPYDVYAEMDFEVPIGKNGDCYDRYLVRMLEMYESVKIIKQCIEKMPQGPVKTDDPKLTPPTRAKMKESMEAMIHHFKLYTEGYDVPAGEIYKAVEAPKGEFGVYLYSTGGNRPYRCRIKAPGFAHLQGLDFMSKGHLMADVITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.571 kDa

MTNNTKSITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAAESLLECEIPRRAQFIRVLFSELTRILNHTLNIGSQALDVGATTPLLWLFEEREKIMEFYERVSGSRMHSNYFRPGGVAEDLPDGLLEDIDKFIQQFPPKLQDIENLLNENRLWKQRLVDIGVVSQKEAMDWGFSGPMLRGSGIAWDLRKSNPYDVYAEMDFEVPIGKNGDCYDRYLVRMLEMYESVKIIKQCIEKMPQGPVKTDDPKLTPPTRAKMKESMEAMIHHFKLYTEGYDVPAGEIYKAVEAPKGEFGVYLYSTGGNRPYRCRIKAPGFAHLQGLDFMSKGHLMADVITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.762 kDa

MTNNIKTITLNLGPQHPATHGVLRLILEMDGEVVNNTDPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAVESLLKCEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGATTPLLWLFEEREKIMEFYERVSGSRMHSNYFRPGGVAEDLPDGLLEDIDKFIEQFHPKLQDVESLLNENRLWKQRLVDIGVVLQQEAMEWGFSGPMLRGSGIAWDLRKSNPYDVYDEIDFEVPIGKNGDCYDRYLVRILEMYESIKIIKQCIEKMPKGAVKTNDPKLTPPTRAKMKESMEAMIHHFKLYTEGYEVPAGETYKAVEAPKGEFGVYLYSIGNNQPYRCRIKTPGFAHLQGLNFMSKGHLMADVITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.599 kDa

MTNNTKTITLNIGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAVESLLECEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGATTPLLWLFEEREKIMEFYEHVSGSRMHSNYFRPGGVAADLPEGLLEDIDKFIEQFPPKLHDIESLLNENRLWKQRLVDIGVASQKEAMDWGFSGPMLRGSGIAWDLRKSNPYDVYDEMDFKVPIGKNGDCYDRYFVRMLEMYESIKIIKQCIEKMPKGAIKTDDPKLTPPTRAKMKESMEAMIHHFKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSQGGNRPYRCRIKAPGFAHLQGLDFMSKGHLMADVITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.64 kDa

MTNNTKTITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAVESLLECEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGATTPLLWLFEEREKIMEFYERVSGSRMHSNYFRPGGVAEDLPDGLLEDIDKFIEQFPPKLHDIESLLNENRLWKQRLVDIGVVSQKEAMDWGFSGPMLRGSGIAWDLRKSNPYDVYDEIDFKVPIGKNGDCYDRYFVRMLEMYESIKIIKQCIEKMPKGAVKTDDPKLTPPTRAKMKESMEAMIHHFKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSQGGNRPYRCRIKAPGFAHLQGLDFISKGHLMADVITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.569 kDa

MTNNTKTITLNLGPQHPATHGVLRLILEMDGEVVNNAVPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAVESLLECEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGATTPLLWLFEEREKIMEFYEHVSGSRMHSNYFRPGGVAADLPEGLLEDIDKFIEQFPPKLHDIESLLNENRLWKQRLVDIGVASQKEAMDWGFSGPMLRGSGIAWDLRKSNPYDVYDEMDFKVPIGKNGDCYDRYFVRMLEMYESIKIIKQCIEKMPKGAVKTDDPKLTPPTRAKMKESMEAMIHHFKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSQGGNRPYRCRIKAPGFAHLQGLDFMSKGHLMADVITIIATLDIVFGEIDR

nuoD

NADH-quinone oxidoreductase subunit D

391 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.